🌎 Ship to: United States
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | cAMP-dependent protein kinase catalytic subunit gamma |
|---|
Gene and Protein Information
| Gene ID | 5568 |
|---|---|
| Uniprot Accession IDs | P22612 O60850 Q5VZ02 Q86YI1 PKA C-gamma |
| Ensembl ID | ENSP00000366488 |
| Symbol | KAPG PKACg BDPLT19 |
| Family | Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. cAMP subfamily. |
| Sequence | MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 472944 | PRKACG | protein kinase cAMP-activated catalytic subunit gamma | 9598 | VGNC:13947 | OMA, EggNOG |
| Macaque | 700652 | PRKACG | protein kinase cAMP-activated catalytic subunit gamma | 9544 | OMA, EggNOG |
Protein Classes
DTO Classes
protein / Kinase / Protein kinase / AGC group / PKA family / Camp-dependent protein kinase catalytic subunit gamma
protein / Kinase / Protein kinase / AGC group / PKA family / Camp-dependent protein kinase catalytic subunit gamma
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.