🌎 Ship to: United States
Navigation umschalten 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | G-protein coupled receptor 15 |
|---|
Gene and Protein Information
| Gene ID | 2838 |
|---|---|
| Uniprot Accession IDs | P49685 Q3MIL4 Q6ISN6 |
| Ensembl ID | ENSP00000284311 |
| Symbol | BOB |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MDPEETSVYLDYYYATSPNSDIRETHSHVPYTSVFLPVFYTAVFLTGVLGNLVLMGALHFKPGSRRLIDIFIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCSVLLLTCMSVDRYLAIVWPVVSRKFRRTDCAYVVCASIWFISCLLGLPTLLSRELTLIDDKPYCAEKKATPIKLIWSLVALIFTFFVPLLSIVTCYCCIARKLCAHYQQSGKHNKKLKKSIKIIFIVVAAFLVSWLPFNTFKFLAIVSGLRQEHYLPSAILQLGMEVSGPLAFANSCVNPFIYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDFARRRKRSVSL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 450102 | GPR15 | G protein-coupled receptor 15 | 9598 | VGNC:7971 | Inparanoid, OMA, EggNOG |
| Macaque | 698718 | GPR15 | G protein-coupled receptor 15 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 71223 | Gpr15 | G protein-coupled receptor 15 | 10090 | MGI:1918473 | Inparanoid, OMA, EggNOG |
| Rat | 288181 | Gpr15 | G protein-coupled receptor 15 | 10116 | RGD:1306639 | Inparanoid, OMA, EggNOG |
| Dog | 487947 | GPR15 | G protein-coupled receptor 15 | 9615 | VGNC:41404 | Inparanoid, OMA, EggNOG |
| Horse | 100072420 | GPR15 | G protein-coupled receptor 15 | 9796 | VGNC:18517 | Inparanoid, OMA, EggNOG |
| Cow | 538740 | GPR15 | G protein-coupled receptor 15 | 9913 | VGNC:29557 | Inparanoid, OMA, EggNOG |
| Pig | 100153787 | GPR15 | G protein-coupled receptor 15 | 9823 | OMA, EggNOG | |
| Chicken | 427956 | GPR15 | G protein-coupled receptor 15 | 9031 | CGNC:11260 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100567777 | gpr15 | G protein-coupled receptor 15 | 28377 | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / G-protein coupled receptor 15
protein / G-protein coupled receptor / Class A rhodopsin like / G-protein coupled receptor 15
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.