Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Mitochondrial mRNA pseudouridine synthase TRUB2 |
|---|
Gene and Protein Information
| Gene ID | 26995 |
|---|---|
| Uniprot Accession IDs | O95900 B7Z7G5 |
| Ensembl ID | ENSP00000361982 |
| Symbol | CLONE24922 |
| Family | Belongs to the pseudouridine synthase TruB family. |
| Sequence | MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRVRFLLGPMEGSEEKELTLTATSVPSFINHPLVCGPAFAHLKVGVGHRLDAQASGVLVLGVGHGCRLLTDMYNAHLTKDYTVRGLLGKATDDFREDGRLVEKTTYDHVTREKLDRILAVIQGSHQKALVMYSNLDLKTQEAYEMAVRGLIRPMNKSPMLITGIRCLYFAPPEFLLEVQCMHETQKELRKLVHEIGLELKTTAVCTQVRRTRDGFFTLDSALLRTQWDLTNIQDAIRAATPQVAAELEKSLSPGLDTKQLPSPGWSWDSQGPSSTLGLERGAGQ Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 464767 | TRUB2 | TruB pseudouridine synthase family member 2 | 9598 | VGNC:10115 | OMA, EggNOG |
| Macaque | 717619 | TRUB2 | TruB pseudouridine synthase family member 2 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 227682 | Trub2 | TruB pseudouridine (psi) synthase family member 2 | 10090 | MGI:2442186 | Inparanoid, OMA, EggNOG |
| Rat | 366012 | Trub2 | TruB pseudouridine synthase family member 2 | 10116 | RGD:1359394 | Inparanoid, OMA, EggNOG |
| Dog | 608574 | TRUB2 | TruB pseudouridine synthase family member 2 | 9615 | VGNC:47889 | Inparanoid, OMA, EggNOG |
| Horse | 100070261 | TRUB2 | TruB pseudouridine synthase family member 2 | 9796 | VGNC:24570 | Inparanoid, OMA, EggNOG |
| Cow | 511988 | TRUB2 | TruB pseudouridine synthase family member 2 | 9913 | VGNC:36405 | Inparanoid, OMA, EggNOG |
| Pig | 100157964 | TRUB2 | TruB pseudouridine synthase family member 2 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100012751 | TRUB2 | TruB pseudouridine synthase family member 2 | 13616 | Inparanoid, EggNOG | |
| Chicken | 417218 | TRUB2 | TruB pseudouridine synthase family member 2 | 9031 | CGNC:3653 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100556023 | trub2 | TruB pseudouridine synthase family member 2 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 496499 | trub2 | TruB pseudouridine (psi) synthase family member 2 | 8364 | XB-GENE-996199 | Inparanoid, OMA, EggNOG |
| Zebrafish | 431747 | trub2 | TruB pseudouridine (psi) synthase family member 2 | 7955 | ZDB-GENE-040704-41 | Inparanoid, OMA, EggNOG |
| C. elegans | 177480 | Y43B11AR.3 | Uncharacterized protein | 6239 | OMA, EggNOG | |
| Fruitfly | 35537 | CG7849 | CG7849 gene product from transcript CG7849-RB | 7227 | FBgn0033060 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.