🌎 Ship to: United States
Navigation umschalten 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | Protein tyrosine phosphatase type IVA 3 |
|---|
Gene and Protein Information
| Gene ID | 11156 |
|---|---|
| Uniprot Accession IDs | O75365 Q8IVN5 Q99849 Q9BTW5 |
| Ensembl ID | ENSP00000332274 |
| Symbol | PRL3 PRL3 PRL-3 PRL-R |
| Family | Belongs to the protein-tyrosine phosphatase family. |
| Sequence | MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 737820 | PTP4A3 | protein tyrosine phosphatase type IVA, member 3 | 9598 | VGNC:50317 | Inparanoid, OMA, EggNOG |
| Macaque | 693703 | PTP4A3 | protein tyrosine phosphatase type IVA, member 3 | 9544 | Inparanoid, OMA | |
| Mouse | 19245 | Ptp4a3 | protein tyrosine phosphatase 4a3 | 10090 | MGI:1277098 | Inparanoid, OMA, EggNOG |
| Rat | 362930 | Ptp4a3 | protein tyrosine phosphatase type IVA, member 3 | 10116 | RGD:1308687 | Inparanoid, OMA, EggNOG |
| Dog | 606961 | PTP4A3 | protein tyrosine phosphatase type IVA, member 3 | 9615 | VGNC:45163 | Inparanoid, OMA, EggNOG |
| Horse | 100058296 | PTP4A3 | protein tyrosine phosphatase type IVA, member 3 | 9796 | VGNC:22006 | Inparanoid, OMA, EggNOG |
| Cow | 100137722 | PTP4A3 | protein tyrosine phosphatase type IVA, member 3 | 9913 | VGNC:33525 | Inparanoid, OMA, EggNOG |
| Opossum | 100032775 | PTP4A3 | protein tyrosine phosphatase type IVA, member 3 | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100554421 | ptp4a3 | protein tyrosine phosphatase type IVA, member 3 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100216017 | ptp4a3 | protein tyrosine phosphatase type IVA, member 3 | 8364 | XB-GENE-943078 | Inparanoid, OMA |
| Zebrafish | 406460 | ptp4a3 | protein tyrosine phosphatase type IVA, member 3 | 7955 | ZDB-GENE-040426-2220 | Inparanoid, OMA, EggNOG |
| Fruitfly | 34952 | PRL-1 | PRL-1 phosphatase | 7227 | FBgn0024734 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.