🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

SERPINB8

BeschreibungSerpin B8

Gene and Protein Information

Gene ID5271
Uniprot Accession IDs P50452 B4DTW2 Q7Z2V6 Q8N178
Ensembl ID ENSP00000381072
Symbol PI8 PI8 CAP2 PI-8 PSS5 C18orf53
FamilyBelongs to the serpin family. Ov-serpin subfamily.
Sequence
MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGFQSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAVVEKALTYEKFKAWTNSEKLTKSKVQVFLPRLKLEESYDLEPFLRRLGMIDAFDEAKADFSGMSTEKNVPLSKVAHKCFVEVNEEGTEAAAATAVVRNSRCSRMEPRFCADHPFLFFIRHHKTNCILFCGRFSSP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp107969517SERPINB8serpin family B member 89598VGNC:9947OMA, EggNOG
Macaque100424017LOC100424017serpin B89544OMA, EggNOG
Mouse20725Serpinb8serine (or cysteine) peptidase inhibitor, clade B, member 810090MGI:894657Inparanoid, OMA, EggNOG
Rat288937Serpinb8serpin family B member 810116RGD:1309833Inparanoid, OMA, EggNOG
Dog607205SERPINB8serpin family B member 89615VGNC:53976Inparanoid, OMA
Horse100051655SERPINB8serpin family B member 89796VGNC:22852Inparanoid, OMA
Cow513825SERPINB8serpin peptidase inhibitor, clade B (ovalbumin), member 89913Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    serine protease inhibitor    /    Serpin B8
DTO Classes
protein    /    Enzyme modulator    /    Protease inhibitor    /    Serine protease inhibitor    /    Serpin B8

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.