🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS CoA Structure
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

ENTPD2

BeschreibungEctonucleoside triphosphate diphosphohydrolase 2

Gene and Protein Information

Gene ID954
Uniprot Accession IDs Q9Y5L3 O15464 Q5SPY6 Q5SPY7 NTPDase 2
Ensembl ID ENSP00000347213
Symbol CD39L1 CD39L1 NTPDase-2
FamilyBelongs to the GDA1/CD39 NTPase family.
Sequence
MAGKVRSLLPPLLLAAAGLAGLLLLCVPTRDVREPPALKYGIVLDAGSSHTSMFIYKWPADKENDTGIVGQHSSCDVPGGGISSYADNPSGASQSLVGCLEQALQDVPKERHAGTPLYLGATAGMRLLNLTNPEASTSVLMAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENFIKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYGQHYRVYTHSFLCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVLLGDVYQSPCTMAQRPQNFNSSARVSLSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVFQPPVAGNFVAFSAFFYTVDFLRTSMGLPVATLQQLEAAAVNVCNQTWAQLQARVPGQRARLADYCAGAMFVQQLLSRGYGFDERAFGGVIFQKKAADTAVGWALGYMLNLTNLIPADPPGLRKGTDFSSWVVLLLLFASALLAALVLLLRQVHSAKLPSTI
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp464883ENTPD2ectonucleoside triphosphate diphosphohydrolase 29598VGNC:13876OMA, EggNOG
Macaque721617ENTPD2ectonucleoside triphosphate diphosphohydrolase 29544Inparanoid, OMA, EggNOG
Mouse12496Entpd2ectonucleoside triphosphate diphosphohydrolase 210090MGI:1096863Inparanoid, OMA, EggNOG
Rat64467Entpd2ectonucleoside triphosphate diphosphohydrolase 210116RGD:69266Inparanoid, OMA, EggNOG
Dog491241ENTPD2ectonucleoside triphosphate diphosphohydrolase 29615VGNC:40381Inparanoid, OMA, EggNOG
Horse100066152ENTPD2ectonucleoside triphosphate diphosphohydrolase 29796VGNC:17596Inparanoid, OMA, EggNOG
Cow100126045ENTPD2ectonucleoside triphosphate diphosphohydrolase 29913VGNC:28509Inparanoid, OMA, EggNOG
Opossum100022598ENTPD2ectonucleoside triphosphate diphosphohydrolase 213616Inparanoid, EggNOG
Anole lizard100561926LOC100561926ectonucleoside triphosphate diphosphohydrolase 228377OMA, EggNOG
Xenopus407961entpd2ectonucleoside triphosphate diphosphohydrolase 28364XB-GENE-5810181Inparanoid, OMA, EggNOG
Zebrafish447905entpd2a.1ectonucleoside triphosphate diphosphohydrolase 2a, tandem duplicate 17955ZDB-GENE-040724-187OMA, EggNOG
Zebrafish569142entpd2bectonucleoside triphosphate diphosphohydrolase 2b7955ZDB-GENE-061013-2Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.