🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

ERP29

BeschreibungEndoplasmic reticulum resident protein 29

Gene and Protein Information

Gene ID10961
Uniprot Accession IDs P30040 C9J183 Q3MJC3 Q6FHT4 ERp29
Ensembl ID ENSP00000261735
Symbol C12orf8 ERP28 ERp28 ERp31 PDIA9 PDI-DB C12orf8 HEL-S-107
Sequence
MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp738376ERP29endoplasmic reticulum protein 299598VGNC:5368OMA, EggNOG
Mouse67397Erp29endoplasmic reticulum protein 2910090MGI:1914647Inparanoid, OMA, EggNOG
Rat117030Erp29endoplasmic reticulum protein 2910116RGD:619781Inparanoid, OMA, EggNOG
Dog477482ERP29endoplasmic reticulum protein 299615VGNC:40468Inparanoid, OMA, EggNOG
Horse100057258ERP29endoplasmic reticulum protein 299796VGNC:17675Inparanoid, OMA, EggNOG
Cow613357ERP29endoplasmic reticulum protein 299913VGNC:28596Inparanoid, OMA, EggNOG
Pig100156625ERP29endoplasmic reticulum protein 299823Inparanoid, OMA, EggNOG
OpossumERP29endoplasmic reticulum protein 29 [Source:HGNC Symbol;Acc:HGNC:13799]13616Inparanoid, OMA, EggNOG
Platypus100074933ERP29endoplasmic reticulum protein 299258Inparanoid, OMA, EggNOG
Chicken416882ERP29endoplasmic reticulum protein 299031CGNC:50366OMA, EggNOG
Anole lizard100558558erp29endoplasmic reticulum protein 2928377Inparanoid, OMA, EggNOG
Xenopuserp29endoplasmic reticulum protein 29 [Source:Xenbase;Acc:XB-GENE-6045950]8364OMA, EggNOG
Fruitfly37206wblwindbeutel7227FBgn0004003Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.