GPR55

BeschreibungG-protein coupled receptor 55

Gene and Protein Information

Gene ID9290
Uniprot Accession IDs Q9Y2T6 Q8N580
Ensembl ID ENSP00000375894
Symbol LPIR1
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MSQQNTSGDCLFDGVNELMKTLQFAVHIPTFVLGLLLNLLAIHGFSTFLKNRWPDYAATSIYMINLAVFDLLLVLSLPFKMVLSQVQSPFPSLCTLVECLYFVSMYGSVFTICFISMDRFLAIRYPLLVSHLRSPRKIFGICCTIWVLVWTGSIPIYSFHGKVEKYMCFHNMSDDTWSAKVFFPLEVFGFLLPMGIMGFCCSRSIHILLGRRDHTQDWVQQKACIYSIAASLAVFVVSFLPVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIRAHRPSRVQLVLQDTTISRG
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp470673GPR55G protein-coupled receptor 559598VGNC:10832OMA, EggNOG
Mouse227326Gpr55G protein-coupled receptor 5510090MGI:2685064Inparanoid, OMA, EggNOG
Rat501177Gpr55G protein-coupled receptor 5510116RGD:1559828Inparanoid, OMA, EggNOG
Dog486157GPR55G protein-coupled receptor 559615VGNC:41438Inparanoid, OMA, EggNOG
HorseGPR55G protein-coupled receptor 55 [Source:HGNC Symbol;Acc:HGNC:4511]9796OMA, EggNOG
Cow539107GPR55G protein-coupled receptor 559913VGNC:29591Inparanoid, OMA, EggNOG
Opossum100021880GPR55G protein-coupled receptor 5513616Inparanoid, OMA, EggNOG
Chicken770641GPR55G protein-coupled receptor 559031CGNC:4131Inparanoid, OMA, EggNOG
Xenopusgpr55G protein-coupled receptor 55 [Source:Xenbase;Acc:XB-GENE-1011165]8364OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    G-protein coupled receptor 55

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.