🌎 Ship to: United States
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | Amiloride-sensitive sodium channel subunit beta |
|---|
Gene and Protein Information
| Gene ID | 6338 |
|---|---|
| Uniprot Accession IDs | P51168 C5HTZ2 O60891 Q96KG2 Q9UJ32 Q9UMU5 |
| Ensembl ID | ENSP00000345751 |
| Symbol | BESC1 ENaCb SCNEB LIDLS1 ENaCbeta |
| Family | Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1B subfamily. |
| Sequence | MHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRIICEGPKKKAMWFLLTLLFAALVCWQWGIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSASEKICNAHGCKMAMRLCSLNRTQCTFRNFTSATQALTEWYILQATNIFAQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERDQSTNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPNTGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 453984 | SCNN1B | sodium channel epithelial 1 beta subunit | 9598 | VGNC:9392 | Inparanoid, OMA, EggNOG |
| Macaque | 700093 | SCNN1B | sodium channel epithelial 1 beta subunit | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 20277 | Scnn1b | sodium channel, nonvoltage-gated 1 beta | 10090 | MGI:104696 | Inparanoid, OMA, EggNOG |
| Rat | 24767 | Scnn1b | sodium channel epithelial 1 beta subunit | 10116 | RGD:3640 | Inparanoid, OMA, EggNOG |
| Dog | 489972 | SCNN1B | sodium channel epithelial 1 beta subunit | 9615 | VGNC:45926 | OMA, EggNOG |
| Horse | 100069008 | SCNN1B | sodium channel epithelial 1 beta subunit | 9796 | VGNC:22745 | Inparanoid, OMA, EggNOG |
| Cow | 533355 | SCNN1B | sodium channel epithelial 1 beta subunit | 9913 | VGNC:34356 | Inparanoid, OMA, EggNOG |
| Pig | 100627971 | SCNN1B | sodium channel epithelial 1 beta subunit | 9823 | OMA, EggNOG | |
| Opossum | 100027536 | SCNN1B | sodium channel epithelial 1 beta subunit | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100079130 | SCNN1B | sodium channel epithelial 1 beta subunit | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 427673 | SCNN1B | sodium channel epithelial 1 beta subunit | 9031 | CGNC:4654 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100567232 | scnn1b | sodium channel epithelial 1 beta subunit | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 779891 | scnn1b | sodium channel, non voltage gated 1 beta subunit | 8364 | XB-GENE-949109 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / transporter / ion channel / Amiloride-sensitive sodium channel subunit beta
protein / transporter / ion channel / Amiloride-sensitive sodium channel subunit beta
DTO Classes
protein / Ion channel / Amiloride-sensitive sodium channel family / SCNN1B subfamily / Amiloride-sensitive sodium channel subunit beta
protein / Ion channel / Amiloride-sensitive sodium channel family / SCNN1B subfamily / Amiloride-sensitive sodium channel subunit beta
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.