🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

SCN2B

BeschreibungSodium channel subunit beta-2

Gene and Protein Information

Gene ID6327
Uniprot Accession IDs O60939 O75302 Q9UNN3
Ensembl ID ENSP00000278947
Symbol ATFB14
FamilyBelongs to the sodium channel auxiliary subunit SCN2B (TC 8.A.17) family.
Sequence
MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEEEGKTDGEGNPDDGAK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Macaque678698SCN2Bsodium voltage-gated channel beta subunit 29544Inparanoid, OMA, EggNOG
Mouse72821Scn2bsodium channel, voltage-gated, type II, beta10090MGI:106921Inparanoid, OMA, EggNOG
Rat25349Scn2bsodium voltage-gated channel beta subunit 210116RGD:3633Inparanoid, OMA, EggNOG
Dog403485SCN2Bsodium voltage-gated channel beta subunit 29615VGNC:45917Inparanoid, OMA, EggNOG
Horse100062848SCN2Bsodium voltage-gated channel beta subunit 29796VGNC:22735Inparanoid, OMA, EggNOG
Cow538722SCN2Bsodium voltage-gated channel beta subunit 29913VGNC:34348Inparanoid, OMA, EggNOG
Pig100514594SCN2Bsodium voltage-gated channel beta subunit 29823OMA, EggNOG
Opossum100025272SCN2Bsodium voltage-gated channel beta subunit 213616Inparanoid, OMA, EggNOG
Chicken419776SCN2Bsodium voltage-gated channel beta subunit 29031CGNC:14499OMA, EggNOG
Anole lizard100560156scn2bsodium voltage-gated channel beta subunit 228377Inparanoid, OMA, EggNOG
Xenopus100144663scn2bsodium voltage-gated channel beta subunit 28364XB-GENE-921739Inparanoid, OMA, EggNOG
Zebrafish777666scn2bsodium channel, voltage-gated, type II, beta7955ZDB-GENE-070920-1Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    transporter    /    cell adhesion molecule    /    Sodium channel subunit beta-2
protein    /    transporter    /    voltage-gated sodium channel    /    Sodium channel subunit beta-2
protein    /    transporter    /    sodium channel    /    Sodium channel subunit beta-2
protein    /    transporter    /    voltage-gated ion channel    /    Sodium channel subunit beta-2
DTO Classes
protein    /    Ion channel    /    Sodium channel auxiliary subunit 1-4 (sca-) family    /    SCN2B family    /    Sodium channel subunit beta-2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.