🌎 Ship to: United States
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | G-protein coupled receptor 6 |
|---|
Gene and Protein Information
| Gene ID | 2830 |
|---|---|
| Uniprot Accession IDs | P46095 B4DHS9 J3KQR3 Q17RJ7 Q5SYL0 |
| Ensembl ID | ENSP00000406986 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MNASAASLNDSQVVVVAAEGAAAAATAAGGPDTGEWGPPAAAALGAGGGANGSLELSSQLSAGPPGLLLPAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADLLAGCGLILHFVFQYLVPSETVSLLTVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRRTLLGVHLLLAATWTVSLGLGLLPVLGWNCLAERAACSVVRPLARSHVALLSAAFFMVFGIMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCVVGSHEDPAVYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQSKVPFRSRSPSEV Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 104001079 | GPR6 | G protein-coupled receptor 6 | 9598 | VGNC:11087 | OMA, EggNOG |
| Macaque | 697979 | GPR6 | G protein-coupled receptor 6 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 140741 | Gpr6 | G protein-coupled receptor 6 | 10090 | MGI:2155249 | Inparanoid, OMA, EggNOG |
| Rat | 83683 | Gpr6 | G protein-coupled receptor 6 | 10116 | RGD:70939 | Inparanoid, OMA, EggNOG |
| Dog | 481959 | GPR6 | G protein-coupled receptor 6 | 9615 | VGNC:41439 | Inparanoid, OMA, EggNOG |
| Cow | 506661 | GPR6 | G protein-coupled receptor 6 | 9913 | VGNC:29592 | Inparanoid, OMA, EggNOG |
| Pig | 100511485 | GPR6 | G protein-coupled receptor 6 | 9823 | OMA, EggNOG | |
| Opossum | 100022066 | GPR6 | G protein-coupled receptor 6 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 101747493 | GPR6 | G protein-coupled receptor 6 | 9031 | CGNC:72019 | Inparanoid, OMA |
| Anole lizard | 100563711 | gpr6 | G protein-coupled receptor 6 | 28377 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / G-protein coupled receptor 6
protein / G-protein coupled receptor / Class A rhodopsin like / G-protein coupled receptor 6
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.