SCTR

BeschreibungSecretin receptor

Gene and Protein Information

Gene ID6344
Uniprot Accession IDs P47872 Q12961 Q13213 Q53T00 SCT-R
Ensembl ID ENSP00000019103
Symbol SR
FamilyBelongs to the G-protein coupled receptor 2 family.
Sequence
MRPHLSPPLQQLLLPVLLACAAHSTGALPRLCDVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRHSYLLKLKVMYTVGYSSSLVMLLVALGILCAFRRLHCTRNYIHMHLFVSFILRALSNFIKDAVLFSSDDVTYCDAHRAGCKLVMVLFQYCIMANYSWLLVEGLYLHTLLAISFFSERKYLQGFVAFGWGSPAIFVALWAIARHFLEDVGCWDINANASIWWIIRGPVILSILINFILFINILRILMRKLRTQETRGNEVSHYKRLARSTLLLIPLFGIHYIVFAFSPEDAMEIQLFFELALGSFQGLVVAVLYCFLNGEVQLEVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp459576SCTRsecretin receptor9598VGNC:2810OMA, EggNOG
Macaque695182SCTRsecretin receptor9544Inparanoid, OMA, EggNOG
Mouse319229Sctrsecretin receptor10090MGI:2441720Inparanoid, OMA, EggNOG
Rat81779Sctrsecretin receptor10116RGD:621342Inparanoid, OMA, EggNOG
Dog483883SCTRsecretin receptor9615VGNC:45934Inparanoid, OMA, EggNOG
Horse100051620SCTRsecretin receptor9796VGNC:51491Inparanoid, OMA, EggNOG
Cow523291SCTRsecretin receptor9913VGNC:34370Inparanoid, OMA, EggNOG
Pig100521045SCTRsecretin receptor9823Inparanoid, EggNOG
Opossum100013364SCTRsecretin receptor13616Inparanoid, OMA, EggNOG
Chicken770943SCTRsecretin receptor9031CGNC:9179Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class B secretin like    /    Glucagon receptor    /    Secretin receptor

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.