🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS CoA Structure
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

GPR84

BeschreibungG-protein coupled receptor 84

Gene and Protein Information

Gene ID53831
Uniprot Accession IDs Q9NQS5 B6V9G7
Ensembl ID ENSP00000450310
Symbol EX33 EX33 GPCR4
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MWNSSDANFSCYHESVLGYRYVAVSWGVVVAVTGTVGNVLTLLALAIQPKLRTRFNLLIANLTLADLLYCTLLQPFSVDTYLHLHWRTGATFCRVFGLLLFASNSVSILTLCLIALGRYLLIAHPKLFPQVFSAKGIVLALVSTWVVGVASFAPLWPIYILVPVVCTCSFDRIRGRPYTTILMGIYFVLGLSSVGIFYCLIHRQVKRAAQALDQYKLRQASIHSNHVARTDEAMPGRFQELDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQPIKGARRAPDSSSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARVQAPRVVHMLAANLTWLNGCINPVLYAAMNRQFRQAYGSILKRGPRSFHRLH
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp467012GPR84G protein-coupled receptor 849598VGNC:8600OMA, EggNOG
Macaque705309GPR84G protein-coupled receptor 849544Inparanoid, OMA, EggNOG
Mouse80910Gpr84G protein-coupled receptor 8410090MGI:1934129Inparanoid, OMA, EggNOG
Rat688730Gpr84G protein-coupled receptor 8410116RGD:1585277Inparanoid, OMA, EggNOG
Dog100687941GPR84G protein-coupled receptor 849615VGNC:41446Inparanoid, OMA, EggNOG
Horse100062469GPR84G protein-coupled receptor 849796VGNC:18550Inparanoid, OMA, EggNOG
Cow540044GPR84G protein-coupled receptor 849913VGNC:29601Inparanoid, OMA, EggNOG
Platypus100084002GPR84G protein-coupled receptor 849258Inparanoid, OMA, EggNOG
Anole lizard100567961gpr84G protein-coupled receptor 8428377Inparanoid, OMA, EggNOG
Xenopus779788gpr84G protein-coupled receptor 848364XB-GENE-491098Inparanoid, OMA, EggNOG
Zebrafish100126017gpr84G protein-coupled receptor 847955ZDB-GENE-070928-33Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    G-protein coupled receptor 84
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Galanin like    /    G-protein coupled receptor 84

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.