Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Phospholipid hydroperoxide glutathione peroxidase |
|---|
Gene and Protein Information
| Gene ID | 2879 |
|---|---|
| Uniprot Accession IDs | P36969 O43381 Q6PJ59 Q9UPK2 PHGPx |
| Ensembl ID | ENSP00000346103 |
| Symbol | MCSP SMDS GPx-4 PHGPx snGPx GSHPx-4 snPHGPx |
| Family | Belongs to the glutathione peroxidase family. |
| Sequence | MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 741876 | GPX4 | glutathione peroxidase 4 | 9598 | VGNC:2549 | Inparanoid, OMA, EggNOG |
| Mouse | 625249 | Gpx4 | glutathione peroxidase 4 | 10090 | MGI:104767 | Inparanoid, OMA, EggNOG |
| Rat | 29328 | Gpx4 | glutathione peroxidase 4 | 10116 | RGD:69226 | Inparanoid, OMA, EggNOG |
| Zebrafish | 352928 | gpx4a | glutathione peroxidase 4a | 7955 | ZDB-GENE-030410-2 | Inparanoid, OMA |
| C. elegans | 187630 | gpx-2 | Glutathione peroxidase | 6239 | Inparanoid, OMA | |
| Fruitfly | 38413 | PHGPx | CG12013 gene product from transcript CG12013-RC | 7227 | FBgn0035438 | Inparanoid, EggNOG |
| S.cerevisiae | 852546 | GPX2 | glutathione peroxidase GPX2 | 4932 | S000000448 | OMA, EggNOG |
| S.cerevisiae | 853842 | GPX1 | glutathione peroxidase GPX1 | 4932 | S000001509 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / oxidoreductase / peroxidase / Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
protein / oxidoreductase / peroxidase / Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
DTO Classes
protein / Enzyme / Oxidoreductase / Peroxidase / Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
protein / Enzyme / Oxidoreductase / Peroxidase / Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.