Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Secretory carrier-associated membrane protein 5 |
|---|
Gene and Protein Information
| Gene ID | 192683 |
|---|---|
| Uniprot Accession IDs | Q8TAC9 B3KPJ7 B7Z762 D3DW71 Q8N3M4 Secretory carrier membrane protein 5 |
| Ensembl ID | ENSP00000355387 |
| Family | Belongs to the SCAMP family. SCAMP5 subfamily. |
| Sequence | MAEKVNNFPPLPKFIPLKPCFYQDFEADIPPQHVSMTKRLYYLWMLNSVTLAVNLVGCLAWLIGGGGATNFGLAFLWLILFTPCSYVCWFRPIYKAFKTDSSFSFMAFFFTFMAQLVISIIQAVGIPGWGVCGWIATISFFGTNIGSAVVMLIPTVMFTVMAVFSFIALSMVHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNEM |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 453752 | SCAMP5 | secretory carrier membrane protein 5 | 9598 | VGNC:1880 | OMA, EggNOG |
| Macaque | 710454 | SCAMP5 | secretory carrier membrane protein 5 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 56807 | Scamp5 | secretory carrier membrane protein 5 | 10090 | MGI:1928948 | Inparanoid, OMA, EggNOG |
| Rat | 65171 | Scamp5 | secretory carrier membrane protein 5 | 10116 | RGD:68356 | Inparanoid, OMA |
| Dog | 478371 | SCAMP5 | secretory carrier membrane protein 5 | 9615 | VGNC:45893 | Inparanoid, OMA, EggNOG |
| Horse | 100061807 | SCAMP5 | secretory carrier membrane protein 5 | 9796 | VGNC:22712 | Inparanoid, OMA, EggNOG |
| Cow | 508510 | SCAMP5 | secretory carrier membrane protein 5 | 9913 | VGNC:34319 | Inparanoid, OMA, EggNOG |
| Pig | 100156508 | SCAMP5 | secretory carrier membrane protein 5 | 9823 | OMA, EggNOG | |
| Opossum | 100030150 | SCAMP5 | secretory carrier membrane protein 5 | 13616 | Inparanoid, EggNOG | |
| Chicken | 426413 | SCAMP5 | secretory carrier membrane protein 5 | 9031 | CGNC:10531 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100554908 | scamp5 | secretory carrier membrane protein 5 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 779947 | scamp5 | secretory carrier membrane protein 5 | 8364 | XB-GENE-1006975 | Inparanoid, OMA, EggNOG |
| Zebrafish | 324467 | scamp5a | secretory carrier membrane protein 5a | 7955 | ZDB-GENE-030131-3188 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.