🌎 Ship to: United States
Navigation umschalten 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 6390 |
|---|---|
| Uniprot Accession IDs | P21912 B2R545 Q0QEY7 Q9NQ12 |
| Ensembl ID | ENSP00000364649 |
| Symbol | SDH SDH1 IP SDH CWS2 PGL4 SDH1 SDH2 SDHIP |
| Family | Belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family. |
| Sequence | MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 456526 | SDHB | succinate dehydrogenase complex iron sulfur subunit B | 9598 | VGNC:8101 | OMA, EggNOG |
| Macaque | 699810 | SDHB | succinate dehydrogenase complex iron sulfur subunit B | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 67680 | Sdhb | succinate dehydrogenase complex, subunit B, iron sulfur (Ip) | 10090 | MGI:1914930 | Inparanoid, OMA, EggNOG |
| Rat | 298596 | Sdhb | succinate dehydrogenase complex iron sulfur subunit B | 10116 | RGD:1308598 | Inparanoid, OMA, EggNOG |
| Dog | 478217 | SDHB | succinate dehydrogenase complex iron sulfur subunit B | 9615 | VGNC:45951 | Inparanoid, OMA, EggNOG |
| Horse | 100050091 | SDHB | succinate dehydrogenase complex iron sulfur subunit B | 9796 | VGNC:22773 | Inparanoid, OMA, EggNOG |
| Cow | 286840 | SDHB | succinate dehydrogenase complex iron sulfur subunit B | 9913 | VGNC:34391 | Inparanoid, OMA, EggNOG |
| Pig | 414412 | SDHB | succinate dehydrogenase complex iron sulfur subunit B | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 751078 | SDHB | succinate dehydrogenase complex iron sulfur subunit B | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100556555 | sdhb | succinate dehydrogenase complex iron sulfur subunit B | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100144957 | sdhb | succinate dehydrogenase complex subunit B, iron sulfur (Ip) | 8364 | XB-GENE-970193 | Inparanoid, OMA, EggNOG |
| Zebrafish | 562149 | sdhb | succinate dehydrogenase complex, subunit B, iron sulfur (Ip) | 7955 | ZDB-GENE-030131-8005 | Inparanoid, OMA, EggNOG |
| C. elegans | 174482 | sdhb-1 | Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 35590 | SdhB | Succinate dehydrogenase, subunit B (iron-sulfur) | 7227 | FBgn0014028 | Inparanoid, OMA, EggNOG |
| S.cerevisiae | 850685 | SDH2 | succinate dehydrogenase iron-sulfur protein subunit SDH2 | 4932 | S000003964 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / oxidoreductase / dehydrogenase / Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
protein / oxidoreductase / dehydrogenase / Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
DTO Classes
protein / Enzyme / Oxidoreductase / Dehydrogenase / Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
protein / Enzyme / Oxidoreductase / Dehydrogenase / Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.