🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

UCP3

BeschreibungMitochondrial uncoupling protein 3

Gene and Protein Information

Gene ID7352
Uniprot Accession IDs P55916 O60475 Q96HL3 UCP 3
Ensembl ID ENSP00000323740
Symbol SLC25A9 SLC25A9
FamilyBelongs to the mitochondrial carrier (TC 2.A.29) family.
Sequence
MVGLKPSDVPPTMAVKFLGAGTAACFADLVTFPLDTAKVRLQIQGENQAVQTARLVQYRGVLGTILTMVRTEGPCSPYNGLVAGLQRQMSFASIRIGLYDSVKQVYTPKGADNSSLTTRILAGCTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWKGTLPNIMRNAIVNCAEVVTYDILKEKLLDYHLLTDNFPCHFVSAFGAGFCATVVASPVDVVKTRYMNSPPGQYFSPLDCMIKMVAQEGPTAFYKGFTPSFLRLGSWNVVMFVTYEQLKRALMKVQMLRESPF
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp748551UCP3uncoupling protein 39598VGNC:10234OMA, EggNOG
Mouse22229Ucp3uncoupling protein 3 (mitochondrial, proton carrier)10090MGI:1099787Inparanoid, OMA, EggNOG
Rat25708Ucp3uncoupling protein 310116RGD:3933Inparanoid, OMA, EggNOG
Dog403575UCP3uncoupling protein 39615Inparanoid, OMA
Horse100052085UCP3uncoupling protein 39796VGNC:24768Inparanoid, OMA, EggNOG
Cow281563UCP3uncoupling protein 39913VGNC:36642Inparanoid, OMA, EggNOG
Pig397116UCP3uncoupling protein 39823Inparanoid, OMA, EggNOG
Opossum619390UCP3mitochondrial uncoupling protein 313616Inparanoid, OMA, EggNOG
Platypus100090617LOC100090617mitochondrial uncoupling protein 39258OMA, EggNOG
Chicken373896UCP3uncoupling protein 39031CGNC:48948Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Transporter    /    SLC superfamily of solute carriers    /    SLC25 family of mitochondrial transporters    /    Mitochondrial uncoupling proteins    /    Mitochondrial uncoupling protein 3

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.