🌎 Ship to: United States
Navigation umschalten 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | Tumor-associated calcium signal transducer 2 |
|---|
Gene and Protein Information
| Gene ID | 4070 |
|---|---|
| Uniprot Accession IDs | P09758 Q15658 Q6FG48 Q7Z7Q4 Q96QD2 |
| Ensembl ID | ENSP00000360269 |
| Symbol | GA733-1 M1S1 TROP2 EGP1 GP50 M1S1 EGP-1 TROP2 GA7331 GA733-1 |
| Family | Belongs to the EPCAM family. |
| Sequence | MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 456890 | TACSTD2 | tumor associated calcium signal transducer 2 | 9598 | OMA, EggNOG | |
| Macaque | 716334 | TACSTD2 | tumor associated calcium signal transducer 2 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 56753 | Tacstd2 | tumor-associated calcium signal transducer 2 | 10090 | MGI:1861606 | Inparanoid, OMA, EggNOG |
| Rat | 494343 | Tacstd2 | tumor-associated calcium signal transducer 2 | 10116 | RGD:1359498 | Inparanoid, OMA, EggNOG |
| Cow | 539853 | TACSTD2 | tumor associated calcium signal transducer 2 | 9913 | VGNC:35563 | Inparanoid, OMA, EggNOG |
| Pig | 100510966 | TACSTD2 | tumor associated calcium signal transducer 2 | 9823 | OMA, EggNOG | |
| Opossum | 100032064 | TACSTD2 | tumor associated calcium signal transducer 2 | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | TACSTD2 | tumor associated calcium signal transducer 2 [Source:HGNC Symbol;Acc:HGNC:11530] | 28377 | Inparanoid, OMA, EggNOG | ||
| Xenopus | 496567 | epcam | epithelial cell adhesion molecule | 8364 | XB-GENE-986667 | OMA, EggNOG |
| Zebrafish | 406454 | epcam | epithelial cell adhesion molecule | 7955 | ZDB-GENE-040426-2209 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.