🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS CoA Structure
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

ELOVL3

BeschreibungElongation of very long chain fatty acids protein 3

Gene and Protein Information

Gene ID83401
Uniprot Accession IDs Q9HB03 Q5VZL3 Q8N180
Ensembl ID ENSP00000359022
Symbol CIG30 CIG30 CIG-30
FamilyBelongs to the ELO family. ELOVL3 subfamily.
Sequence
MVTAMNVSHEVNQLFQPYNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVFLLSKVIELGDTAFIILRKRPLIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVTMNFGVHAIMYTYYTLKAANVKPPKMLPMLITSLQILQMFVGAIVSILTYIWRQDQGCHTTMEHLFWSFILYMTYFILFAHFFCQTYIRPKVKAKTKSQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp745450ELOVL3ELOVL fatty acid elongase 39598VGNC:7275OMA, EggNOG
Macaque712927ELOVL3ELOVL fatty acid elongase 39544Inparanoid, OMA, EggNOG
Mouse12686Elovl3elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 310090MGI:1195976Inparanoid, OMA, EggNOG
Rat309449Elovl3ELOVL fatty acid elongase 310116RGD:1307263Inparanoid, OMA, EggNOG
Dog486855ELOVL3ELOVL fatty acid elongase 39615VGNC:40321Inparanoid, OMA, EggNOG
Horse100060081ELOVL3ELOVL fatty acid elongase 39796VGNC:17539Inparanoid, OMA, EggNOG
Cow539782ELOVL3ELOVL fatty acid elongase 39913VGNC:28449Inparanoid, OMA, EggNOG
Pig100155434ELOVL3ELOVL fatty acid elongase 39823Inparanoid, OMA, EggNOG
Opossum100029282ELOVL3ELOVL fatty acid elongase 313616Inparanoid, EggNOG
Platypus100080155ELOVL3ELOVL fatty acid elongase 39258Inparanoid, OMA, EggNOG
C. elegans183948elo-3Putative fatty acid elongation protein 36239Inparanoid, OMA
S.cerevisiae853243ELO1fatty acid elongase ELO14932S000003732Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    transferase    /    acyltransferase    /    Elongation of very long chain fatty acids protein 3
DTO Classes
protein    /    Enzyme    /    Transferase    /    Acyltransferase    /    Elongation of very long chain fatty acids protein 3

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.