🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

TBCA

BeschreibungTubulin-specific chaperone A

Gene and Protein Information

Gene ID6902
Uniprot Accession IDs O75347 B4DT30
Ensembl ID ENSP00000306362
FamilyBelongs to the TBCA family.
Sequence
MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp737862TBCAtubulin folding cofactor A9598VGNC:4189OMA, EggNOG
Mouse21371Tbcatubulin cofactor A10090MGI:107549Inparanoid, OMA, EggNOG
Rat366995Tbcatubulin folding cofactor A10116RGD:1311538Inparanoid, OMA
Dog479173TBCAtubulin folding cofactor A9615VGNC:53246Inparanoid, OMA, EggNOG
HorseTBCAtubulin folding cofactor A [Source:HGNC Symbol;Acc:HGNC:11579]9796OMA, EggNOG
Cow327683TBCAtubulin folding cofactor A9913VGNC:35648Inparanoid, OMA, EggNOG
Pig100523593TBCAtubulin folding cofactor A9823OMA, EggNOG
Opossum100032660TBCAtubulin folding cofactor A13616Inparanoid, OMA, EggNOG
Platypus100083575TBCAtubulin folding cofactor A9258Inparanoid, OMA, EggNOG
Chicken416367TBCAtubulin folding cofactor A9031CGNC:3204Inparanoid, OMA, EggNOG
Anole lizard100559239tbcatubulin folding cofactor A28377OMA, EggNOG
Xenopus100038159tbcatubulin folding cofactor A8364XB-GENE-490490Inparanoid, OMA, EggNOG
Zebrafish394029tbcatubulin cofactor a7955ZDB-GENE-040426-962Inparanoid, OMA, EggNOG
C. elegans171791tbca-1Tubulin-specific chaperone A6239OMA, EggNOG
Fruitfly43737CG1890CG1890 gene product from transcript CG1890-RA7227FBgn0039869Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    chaperone    /    chaperonin    /    Tubulin-specific chaperone A
DTO Classes
protein    /    Chaperone    /    Chaperonin    /    Tubulin-specific chaperone A

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.