🌎 Ship to: United States
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | Protein tyrosine phosphatase type IVA 1 |
|---|
Gene and Protein Information
| Gene ID | 7803 |
|---|---|
| Uniprot Accession IDs | Q93096 B2R6C8 O00648 Q49A54 |
| Ensembl ID | ENSP00000359685 |
| Symbol | PRL1 PTPCAAX1 HH72 PRL1 PRL-1 PTPCAAX1 PTP(CAAX1) |
| Family | Belongs to the protein-tyrosine phosphatase family. |
| Sequence | MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 716195 | PTP4A1 | protein tyrosine phosphatase type IVA, member 1 | 9544 | Inparanoid, OMA | |
| Mouse | 19243 | Ptp4a1 | protein tyrosine phosphatase 4a1 | 10090 | MGI:1277096 | Inparanoid, OMA, EggNOG |
| Rat | 29463 | Ptp4a1 | protein tyrosine phosphatase type IVA, member 1 | 10116 | RGD:61970 | Inparanoid, OMA |
| Dog | 481863 | PTP4A1 | protein tyrosine phosphatase type IVA, member 1 | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | 100057042 | PTP4A1 | protein tyrosine phosphatase type IVA, member 1 | 9796 | VGNC:22005 | Inparanoid, OMA, EggNOG |
| Cow | 613326 | PTP4A1 | protein tyrosine phosphatase type IVA, member 1 | 9913 | VGNC:33523 | Inparanoid, OMA |
| Opossum | 100015403 | PTP4A1 | protein tyrosine phosphatase type IVA, member 1 | 13616 | Inparanoid, OMA | |
| Platypus | 100073737 | PTP4A1 | protein tyrosine phosphatase type IVA, member 1 | 9258 | Inparanoid, OMA | |
| Chicken | 421877 | PTP4A1 | protein tyrosine phosphatase type IVA, member 1 | 9031 | CGNC:51557 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100560135 | ptp4a1 | protein tyrosine phosphatase type IVA, member 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 493615 | ptp4a1 | protein tyrosine phosphatase type IVA, member 1 | 7955 | ZDB-GENE-041121-11 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.