Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Mitochondrial import receptor subunit TOM34 |
|---|
Gene and Protein Information
| Gene ID | 10953 |
|---|---|
| Uniprot Accession IDs | Q15785 Q53GH9 Q6IBN7 Q9NTZ3 hTom34 |
| Ensembl ID | ENSP00000361900 |
| Symbol | URCC3 TOM34 URCC3 HTOM34P |
| Family | Belongs to the Tom34 family. |
| Sequence | MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 458274 | TOMM34 | translocase of outer mitochondrial membrane 34 | 9598 | VGNC:6285 | Inparanoid, OMA, EggNOG |
| Mouse | 67145 | Tomm34 | translocase of outer mitochondrial membrane 34 | 10090 | MGI:1914395 | Inparanoid, OMA, EggNOG |
| Rat | 311621 | Tomm34 | translocase of outer mitochondrial membrane 34 | 10116 | RGD:1309029 | Inparanoid, OMA |
| Dog | 477239 | TOMM34 | translocase of outer mitochondrial membrane 34 | 9615 | VGNC:49628 | Inparanoid, OMA, EggNOG |
| Horse | 100070847 | TOMM34 | translocase of outer mitochondrial membrane 34 | 9796 | VGNC:50511 | Inparanoid, OMA, EggNOG |
| Cow | 508142 | TOMM34 | translocase of outer mitochondrial membrane 34 | 9913 | VGNC:49135 | Inparanoid, OMA, EggNOG |
| Pig | 100157194 | TOMM34 | translocase of outer mitochondrial membrane 34 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | TOMM34 | translocase of outer mitochondrial membrane 34 [Source:HGNC Symbol;Acc:HGNC:15746] | 13616 | Inparanoid, EggNOG | ||
| Chicken | 419188 | TOMM34 | translocase of outer mitochondrial membrane 34 | 9031 | CGNC:3015 | Inparanoid, OMA |
| Anole lizard | 100561170 | tomm34 | translocase of outer mitochondrial membrane 34 | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 323361 | tomm34 | translocase of outer mitochondrial membrane 34 | 7955 | ZDB-GENE-030131-2081 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.