Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Transcription factor A, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 7019 |
|---|---|
| Uniprot Accession IDs | Q00059 A8MRB2 A9QXC6 B5BU05 Q5U0C6 mtTFA |
| Ensembl ID | ENSP00000420588 |
| Symbol | TCF6 TCF6L2 TCF6 MTTF1 MTTFA TCF6L1 TCF6L2 TCF6L3 MTDPS15 |
| Sequence | MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 466079 | TFAM | transcription factor A, mitochondrial | 9598 | VGNC:12509 | Inparanoid, OMA |
| Macaque | 701368 | TFAM | transcription factor A, mitochondrial | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 21780 | Tfam | transcription factor A, mitochondrial | 10090 | MGI:107810 | Inparanoid, OMA, EggNOG |
| Rat | 83474 | Tfam | transcription factor A, mitochondrial | 10116 | RGD:620682 | Inparanoid, OMA, EggNOG |
| Dog | 488989 | TFAM | transcription factor A, mitochondrial | 9615 | VGNC:47282 | Inparanoid, OMA, EggNOG |
| Horse | 100062631 | TFAM | transcription factor A, mitochondrial | 9796 | VGNC:24027 | Inparanoid, OMA, EggNOG |
| Cow | 510059 | TFAM | transcription factor A, mitochondrial | 9913 | VGNC:35775 | Inparanoid, OMA, EggNOG |
| Platypus | 100076559 | LOC100076559 | transcription factor A, mitochondrial-like | 9258 | OMA, EggNOG | |
| Chicken | 373888 | TFAM | transcription factor A, mitochondrial | 9031 | CGNC:1948 | Inparanoid, OMA |
| Anole lizard | 100560145 | tfam | transcription factor A, mitochondrial | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100135718 | tfam | transcription factor A, mitochondrial | 8364 | XB-GENE-978256 | Inparanoid, OMA, EggNOG |
| Zebrafish | 571106 | tfam | transcription factor A, mitochondrial | 7955 | ZDB-GENE-061013-552 | Inparanoid, OMA, EggNOG |
| C. elegans | 177543 | hmg-5 | HMG | 6239 | Inparanoid, OMA | |
| Fruitfly | 42433 | TFAM | mitochondrial transcription factor A | 7227 | FBgn0038805 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.