Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Secretagogin |
|---|
Gene and Protein Information
| Gene ID | 10590 |
|---|---|
| Uniprot Accession IDs | O76038 A8K0B2 Q5VV44 Q96QV7 Q9UJF6 |
| Ensembl ID | ENSP00000367197 |
| Symbol | SECRET SEGN CALBL SECRET setagin DJ501N12.8 |
| Sequence | MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 462485 | SCGN | secretagogin, EF-hand calcium binding protein | 9598 | VGNC:3695 | OMA, EggNOG |
| Macaque | 694072 | SCGN | secretagogin, EF-hand calcium binding protein | 9544 | Inparanoid, OMA | |
| Mouse | 214189 | Scgn | secretagogin, EF-hand calcium binding protein | 10090 | MGI:2384873 | Inparanoid, OMA, EggNOG |
| Rat | 306942 | Scgn | secretagogin, EF-hand calcium binding protein | 10116 | RGD:1303281 | Inparanoid, OMA, EggNOG |
| Dog | 610954 | SCGN | secretagogin, EF-hand calcium binding protein | 9615 | VGNC:45909 | Inparanoid, OMA, EggNOG |
| Horse | 100067986 | SCGN | secretagogin, EF-hand calcium binding protein | 9796 | VGNC:22725 | Inparanoid, OMA, EggNOG |
| Cow | 618206 | SCGN | secretagogin, EF-hand calcium binding protein | 9913 | VGNC:34337 | Inparanoid, OMA, EggNOG |
| Pig | 768111 | SCGN | secretagogin, EF-hand calcium binding protein | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | SCGN | secretagogin, EF-hand calcium binding protein [Source:HGNC Symbol;Acc:HGNC:16941] | 13616 | Inparanoid, OMA, EggNOG | ||
| Platypus | 100087054 | SCGN | secretagogin, EF-hand calcium binding protein | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 421001 | SCGN | secretagogin, EF-hand calcium binding protein | 9031 | CGNC:10196 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100566868 | scgn | secretagogin, EF-hand calcium binding protein | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 780242 | scgn | secretagogin, EF-hand calcium binding protein | 8364 | XB-GENE-988344 | Inparanoid, OMA, EggNOG |
| Zebrafish | 573010 | scgn | secretagogin, EF-hand calcium binding protein | 7955 | ZDB-GENE-041010-82 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.