🌎 Versand an: United States
Navigation umschalten
Warenkorb
Suche
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Struktur Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

SHBG

BeschreibungSex hormone-binding globulin

Gene and Protein Information

Gene ID6462
Uniprot Accession IDs P04278 B0FWH4 E9PGW1 F5H5Z8 I3L1N7 P14689 Q16616 Q3MIL0 Q6ISD2 SHBG
Ensembl ID ENSP00000369816
Symbol ABP SBP TEBG
Sequence
MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp455215SHBGsex hormone binding globulin9598VGNC:9607OMA, EggNOG
Macaque716004SHBGsex hormone binding globulin9544Inparanoid, OMA, EggNOG
Mouse20415Shbgsex hormone binding globulin10090MGI:98295Inparanoid, OMA, EggNOG
Rat24775Shbgsex hormone binding globulin10116RGD:3671Inparanoid, OMA, EggNOG
Dog100856157SHBGsex hormone binding globulin9615VGNC:46139Inparanoid, OMA, EggNOG
Horse100073011SHBGsex hormone binding globulin9796VGNC:22954Inparanoid, OMA, EggNOG
Cow404182SHBGsex hormone binding globulin9913VGNC:34589Inparanoid, OMA, EggNOG
Opossum100015497SHBGsex hormone binding globulin13616Inparanoid, OMA, EggNOG
Zebrafish322604shbgsex hormone-binding globulin7955ZDB-GENE-030131-1324Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpezifikationenSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Dürfen wir Sie über Rabattaktionen informieren?

      Später erinnern

      Vielen Dank! Bitte überprüfen Sie Ihren E-Mail-Posteingang, um zu bestätigen.

      Hoppla! Benachrichtigungen sind deaktiviert.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.