Toggle Nav 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | GDNF family receptor alpha-like |
|---|
Gene and Protein Information
| Gene ID | 389400 |
|---|---|
| Uniprot Accession IDs | Q6UXV0 Q5VTF6 |
| Ensembl ID | ENSP00000343636 |
| Symbol | C6orf144 GRAL UNQ9356 C6orf144 bA360D14.1 |
| Family | Belongs to the GDNFR family. |
| Sequence | MIVFIFLAMGLSLENEYTSQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGEVIYAAMCMTVTCGILLLVMVKLRTSRISSKARDPSSIQIPGEL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 743306 | GFRAL | GDNF family receptor alpha like | 9598 | VGNC:2838 | OMA, EggNOG |
| Mouse | 404194 | Gfral | GDNF family receptor alpha like | 10090 | MGI:3607786 | Inparanoid, OMA, EggNOG |
| Rat | 501023 | Gfral | GDNF family receptor alpha like | 10116 | RGD:1565220 | Inparanoid, OMA, EggNOG |
| Dog | 481851 | GFRAL | GDNF family receptor alpha like | 9615 | VGNC:41192 | Inparanoid, OMA, EggNOG |
| Horse | 100069686 | GFRAL | GDNF family receptor alpha like | 9796 | VGNC:18319 | Inparanoid, OMA, EggNOG |
| Cow | 531956 | GFRAL | GDNF family receptor alpha like | 9913 | VGNC:53972 | Inparanoid, OMA, EggNOG |
| Pig | 100521501 | GFRAL | GDNF family receptor alpha like | 9823 | Inparanoid, OMA, EggNOG | |
| Chicken | 421887 | GFRAL | GDNF family receptor alpha like | 9031 | CGNC:12187 | OMA, EggNOG |
| Anole lizard | GFRAL | GDNF family receptor alpha like [Source:HGNC Symbol;Acc:HGNC:32789] | 28377 | Inparanoid, OMA, EggNOG | ||
| Zebrafish | 561326 | gfral | GDNF family receptor alpha like | 7955 | ZDB-GENE-110607-2 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.