🌎 Versand an: United States
Navigation umschalten
Warenkorb
Suche
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Struktur Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

PTGER2

BeschreibungProstaglandin E2 receptor EP2 subtype

Gene and Protein Information

Gene ID5732
Uniprot Accession IDs P43116 D3DSC0 Q52LG8 PGE receptor EP2 subtype
Ensembl ID ENSP00000245457
Symbol EP2
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGRRSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFSLATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQYCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGSGRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQALRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp467459PTGER2prostaglandin E receptor 29598VGNC:3332OMA, EggNOG
Macaque708024PTGER2prostaglandin E receptor 29544Inparanoid, OMA, EggNOG
Mouse19217Ptger2prostaglandin E receptor 2 (subtype EP2)10090MGI:97794Inparanoid, OMA, EggNOG
Rat81752Ptger2prostaglandin E receptor 210116RGD:620020Inparanoid, OMA, EggNOG
Dog403797PTGER2prostaglandin E receptor 29615VGNC:45143Inparanoid, OMA, EggNOG
Horse100067279PTGER2prostaglandin E receptor 29796VGNC:21987Inparanoid, OMA, EggNOG
Cow282329PTGER2prostaglandin E receptor 29913VGNC:33502Inparanoid, OMA, EggNOG
PigPTGER2prostaglandin E receptor 2 [Source:HGNC Symbol;Acc:HGNC:9594]9823OMA, EggNOG
Opossum100015803PTGER2prostaglandin E receptor 213616Inparanoid, EggNOG
PlatypusPTGER2prostaglandin E receptor 2 [Source:HGNC Symbol;Acc:HGNC:9594]9258OMA, EggNOG
Anole lizardPTGER2prostaglandin E receptor 2 [Source:HGNC Symbol;Acc:HGNC:9594]28377Inparanoid, OMA, EggNOG
Xenopus100493226ptger2prostaglandin E receptor 28364XB-GENE-967341Inparanoid, OMA, EggNOG
Zebrafish570410ptger2bprostaglandin E receptor 2b (subtype EP2)7955ZDB-GENE-040724-267Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Prostaglandin E2 receptor EP2 subtype
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Prostaglandin E2 receptor EP2 subtype

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpezifikationenSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Dürfen wir Sie über Rabattaktionen informieren?

      Später erinnern

      Vielen Dank! Bitte überprüfen Sie Ihren E-Mail-Posteingang, um zu bestätigen.

      Hoppla! Benachrichtigungen sind deaktiviert.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.