Recombinant Human TGF-beta 1 GMP Protein

Cat. No.: rp168406-GMP
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. ≥97%(SDS-PAGE&SEC-HPLC)
Expression System
CHO
Accession #
P01137.2
Protein Tag
No tag
Expression system
CHO
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured by its ability to inhibit the IL-4-dependent proliferation of HT‑2 mouse T cells. The ED50 for this effect is 0.04-0.2 ng/mL.The specific activity of recombinant human TGF-β1 GMP is >1.0 x 10^7 units/mg, which is calibrated against the human TGF‑β1 Standard (NIBSC code: 89/514).
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp168406-GMP-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
394,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,≥97%(SDS-PAGE&SEC-HPLC) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human TGF-beta 1 GMP Protein
Sinónimos
CED | LAP | DPD1 | latency-associated peptide | TGF beta | TGF beta1 | TGFB | TGFB1 | TGF-beta 1 protein | TGFbeta 1 | TGF-beta 1 | TGFbeta | TGF-beta-1 | transforming growth factor beta-1 | transforming growth factor, beta 1 | IBDIMDE
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, ≥97%(SDS-PAGE&SEC-HPLC)
Mecanismos bioquímicos y fisiológicos
Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an impo
Bioactividad
Measured by its ability to inhibit the IL-4-dependent proliferation of HT‑2 mouse T cells. The ED50 for this effect is 0.04-0.2 ng/mL.The specific activity of recombinant human TGF-β1 GMP is >1.0 x 10^7 units/mg, which is calibrated against the human TGF‑β1 Standard (NIBSC code: 89/514).
Concentración de endotoxinas
<0.1 EU/μg
Sistema de expresión
CHO
Aminoácidos
279-390 aa
Secuencia
ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Etiqueta proteínica
No tag
Secuencia N-terminal
Ala-Leu-Asp-Thr-Asn-Tyr-(Cys)-Phe-Ser-Ser
Número de adhesión
Peso molecular previsto
12.8 kDa (monomer)
SDS-PAGE
12 kDa, under reducing conditions. 24 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
Reconstitute at 100 μg/mL in 4 mM HCl.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
A minimum of 12 months when stored at ≤ -20 ℃ as supplied. 1 month, 2 to 8 ℃ under sterile conditions after reconstitution. 3 months, ≤ -28 ℃ under sterile conditions after reconstitution. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycl

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.