Recombinant Human TGF-beta 1 Monomer Protein

Cat. No.: rp176238
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
P01137
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human TGF-beta 1 Monomer protein (rp176238) at 1.0 μg/mL can bind Recombinant TGF beta 1 Antibody (Ab130853) with the EC50 of 5 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp176238-10μg
7
109,90US$
50μg
rp176238-50μg
4
499,90US$
100μg
rp176238-100μg
4
799,90US$
1mg
rp176238-1mg
1
3.659,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,His-Tag,≥95%(SDS-PAGE) ActiBioPure™,Bioactive,Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

TGF beta 1 (transforming growth factor beta 1) is one of three closely related mammalian members of the large TGF beta superfamily that share a characteristic cystine knot structure. TGF beta 1, 2 and 3 are highly pleiotropic cytokines that are proposed to act as cellular switches that regulate processes such as immune function, proliferation and epithelial mesenchymal transition. Each TGF beta isoform has some non redundant functions; for TGF beta 1, mice with targeted deletion show defects in hematopoiesis and endothelial differentiation, and die of overwhelming inflammation. Human TGF beta 1 cDNA encodes a 390 amino acid (aa) precursor that contains a 29 aa signal peptide and a 361 aa proprotein. A furin-like convertase processes the proprotein to generate an N terminal 249 aa latency associated peptide (LAP) and a C terminal 112 aa mature TGF beta 1. Disulfide-linked homodimers of LAP and TGF beta 1 remain non covalently associated after secretion, forming the small latent TGF beta 1 complex. Covalent linkage of LAP to one of three latent TGF beta binding proteins (LTBPs) creates a large latent complex that may interact with the extracellular matrix. TGF beta is activated from latency by pathways that include actions of the protease plasmin, matrix metalloproteases, thrombospondin 1 and a subset of integrins. Mature human TGF beta 1 shares 100% aa identity with pig, dog and cow TGF beta 1, and 99% aa identity with mouse, rat and horse TGF beta 1. It demonstrates cross species activity. TGF beta 1 signaling begins with high affinity binding to a type II ser/thr kinase receptor termed TGF beta RII. This receptor then phosphorylates and activates a second ser/thr kinase receptor, TGF beta RI (also called activin receptor like kinase (ALK) 5), or alternatively, ALK 1. This complex phosphorylates and activates Smad proteins that regulate transcription. Contributions of the accessory receptors betaglycan (also known as TGF beta RIII) and endoglin, or use of Smad-independent signaling pathways, allow for disparate actions observed in response to TGF beta in different contexts.

Specifications

Product Name
Recombinant Human TGF-beta 1 Monomer Protein
Sinónimos
DPD1 | CEDLAP | latency-associated peptide | TGF beta | TGF beta1 | TGFB | TGFB1 | TGF-beta 1 protein | TGFbeta 1 | TGF-beta 1 | TGFbeta | TGF-beta-1 | transforming growth factor beta-1 | transforming growth factor, beta 1
Grado
ActiBioPure™, Bioactive, Carrier Free, His Tag
Especificaciones y pureza
Carrier Free, Bioactive, ActiBioPure™, His-Tag, ≥95%(SDS-PAGE)
Bioactividad
Immobilized Recombinant Human TGF-beta 1 Monomer protein (rp176238) at 1.0 μg/mL can bind Recombinant TGF beta 1 Antibody (Ab130853) with the EC50 of 5 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
E. coli
Aminoácidos
279-390 aa
Secuencia
MGSSHHHHHHSSGLVPRGSHMALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Etiqueta proteínica
N-His
Número de adhesión
Peso molecular previsto
15.1 kDa
SDS-PAGE
13.9 kDa, under reducing conditions; 13.7 & 28.8 kDa, under non-reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile 4mM HCl, pH 3.0. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Imágenes

Recombinant Human TGF-beta 1 Monomer Protein (rp176238) - ELISA
Immobilized Recombinant Human TGF-beta 1 Monomer Protein (rp176238) at 1.0 μg/mL can bind Recombinant TGF beta 1 Antibody (Ab130853) with the EC ₅₀  of 5 ng/mL.

Recombinant Human TGF-beta 1 Monomer Protein (rp176238) - SDS-PAGE
3 μg/lane of Recombinant Human TGF-beta 1 Monomer Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 13.9 kDa under reducing conditions and 13.7 & 28.8 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

5 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F0809255Certificate of AnalysisMar 13, 2026 rp176238
ZJ24F0809256Certificate of AnalysisMar 13, 2026 rp176238
ZJ24F0809257Certificate of AnalysisMar 13, 2026 rp176238
ZJ24F0809258Certificate of AnalysisMar 13, 2026 rp176238
ZJ24R0700830Certificate of AnalysisJul 26, 2024 rp176238
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.