Recombinant Human IGFBP-6 Protein

Cat. No.: rp147288
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥97%(SDS-PAGE)
Expression System
HEK293
Accession #
P24592
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
1、Measured by its ability to inhibit the biological activity of IGF-I on MCF‑7 human breast cancer cells. The ED50 for this effect is 5.71 ng/mL in the presence of 2 ng/mL Recombinant Human IGF-1(rp147252). 2、Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human IGFBP-6 Protein (rp147288) at 1 μg/mL can bind Human IGF-1 Protein, the ED50 for this effect is 131.2 ng/mL.
Size
Status
Price
Qty
10μg
rp147288-10μg
≥10
$139.90
50μg
rp147288-50μg
3
$415.90
100μg
rp147288-100μg
1
$665.90
1mg
rp147288-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$4,389.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His-Tag,≥97%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human IGFBP-6 Protein
Synonyms
IBP-6 | IGF-binding protein 6 | IGFBP-6 | IBP6 | IBP-6 | IGF binding protein 6 | IGF-binding protein 6 | IGFBP6 | IGFBP-6 | insulin-like growth factor binding protein 6 | insulin-like growth factor-binding protein 6
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, His Tag
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, His-Tag, ≥97%(SDS-PAGE)
Biochemical and Physiological Mechanisms
IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
Bioactivity
1、Measured by its ability to inhibit the biological activity of IGF-I on MCF‑7 human breast cancer cells. The ED50 for this effect is 5.71 ng/mL in the presence of 2 ng/mL Recombinant Human IGF-1(rp147252). 2、Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human IGFBP-6 Protein (rp147288) at 1 μg/mL can bind Human IGF-1 Protein, the ED50 for this effect is 131.2 ng/mL.
Endotoxin Concentration
<0.1 EU/μg
Expression System
HEK293
Species
Human
Amino Acids
25-240 aa
Sequence
ALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSGHHHHHH
Protein Tag
C-His
Accession #
Predicted molecular weight
23.7 kDa
SDS-PAGE
30 - 37 kDa, under reducing conditions; 27 - 34 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Shape
Liquid
Reconstitution
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images

Recombinant Human IGFBP-6 Protein (rp147288) - SDS-PAGE
2 μg/lane of Recombinant Human IGFBP-6 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 30 - 37 kDa under reducing condition and 27 - 34 kDa under non-reducing condition.

Recombinant Human IGFBP-6 Protein (rp147288) - Protein Bioactivity
Measured by its ability to inhibit the biological activity of IGF-I on MCF‑7 human breast cancer cells. The ED50 for this effect is 5.71 ng/mL in the presence of 2 ng/mL Recombinant Human IGF-1(rp147252).

Recombinant Human IGFBP-6 Protein (rp147288) - Protein Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human IGFBP-6 Protein (rp147288) at 1 μg/mL can bind Human IGF-1 Protein, the ED50 for this effect is 131.2 ng/mL.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ25F0420306Certificate of AnalysisFeb 24, 2026 rp147288
ZJ25F0420307Certificate of AnalysisFeb 24, 2026 rp147288
ZJ25F0420308Certificate of AnalysisFeb 24, 2026 rp147288
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.