224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Methyl-CpG-binding domain protein 3 |
|---|
Gene and Protein Information
| Gene ID | 53615 |
|---|---|
| Uniprot Accession IDs | O95983 A8K4B7 D6W5Z2 Q6PIL9 Q6PJZ9 Q86XF4 |
| Ensembl ID | ENSP00000412302 |
| Sequence | MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEEEEPDPDPEMEHV |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 455554 | MBD3 | methyl-CpG binding domain protein 3 | 9598 | VGNC:6637 | OMA, EggNOG |
| Macaque | 708302 | MBD3 | methyl-CpG binding domain protein 3 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 17192 | Mbd3 | methyl-CpG binding domain protein 3 | 10090 | MGI:1333812 | Inparanoid, OMA |
| Rat | 362834 | Mbd3 | methyl-CpG binding domain protein 3 | 10116 | RGD:1307389 | Inparanoid, OMA |
| Dog | 485080 | MBD3 | methyl-CpG binding domain protein 3 | 9615 | VGNC:43050 | Inparanoid, OMA |
| Opossum | 100013381 | MBD3 | methyl-CpG binding domain protein 3 | 13616 | Inparanoid, OMA | |
| Platypus | 100076323 | MBD3 | methyl-CpG binding domain protein 3 | 9258 | Inparanoid, OMA | |
| Chicken | 770153 | MBD3 | methyl-CpG binding domain protein 3 | 9031 | CGNC:55815 | Inparanoid, OMA |
| Xenopus | 448748 | mbd3 | methyl-CpG binding domain protein 3 | 8364 | XB-GENE-491553 | Inparanoid, OMA, EggNOG |
| Zebrafish | 337133 | mbd3a | methyl-CpG binding domain protein 3a | 7955 | ZDB-GENE-030131-9077 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.