🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

MDH1

DescriptionMalate dehydrogenase, cytoplasmic

Gene and Protein Information

Gene ID4190
Uniprot Accession IDs P40925 B2R5V5 B4DUN2 B7Z3I7 F5H098 Q6I9V0
Ensembl ID ENSP00000438144
Symbol MDHA MDHA MOR2 MDH-s HEL-S-32 MGC:1375
FamilyBelongs to the LDH/MDH superfamily. MDH type 2 family.
Sequence
MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp459271MDH1malate dehydrogenase 19598VGNC:2925OMA, EggNOG
Macaque694703MDH1malate dehydrogenase 19544Inparanoid, OMA, EggNOG
Mouse17449Mdh1malate dehydrogenase 1, NAD (soluble)10090MGI:97051Inparanoid, OMA, EggNOG
Rat24551Mdh1malate dehydrogenase 110116RGD:3072Inparanoid, OMA, EggNOG
Dog474614MDH1malate dehydrogenase 19615VGNC:43103Inparanoid, OMA, EggNOG
Horse100051612MDH1malate dehydrogenase 19796VGNC:20056Inparanoid, OMA, EggNOG
Cow535182MDH1malate dehydrogenase 19913VGNC:31333Inparanoid, OMA, EggNOG
Opossum100031872MDH1malate dehydrogenase 113616Inparanoid, EggNOG
Platypus100082315MDH1malate dehydrogenase 19258Inparanoid, OMA, EggNOG
Chicken421281MDH1malate dehydrogenase 19031CGNC:6725Inparanoid, OMA, EggNOG
Anole lizard100553622mdh1malate dehydrogenase 128377Inparanoid, OMA, EggNOG
Xenopus448318mdh1malate dehydrogenase 18364XB-GENE-484872Inparanoid, OMA, EggNOG
Zebrafish399662mdh1aamalate dehydrogenase 1Aa, NAD (soluble)7955ZDB-GENE-040204-1OMA, EggNOG
Fruitfly34414Mdh1Malate dehydrogenase 17227FBgn0262782Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    dehydrogenase    /    Malate dehydrogenase, cytoplasmic
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Dehydrogenase    /    Malate dehydrogenase, cytoplasmic

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.