🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

BCAM

DescriptionBasal cell adhesion molecule

Gene and Protein Information

Gene ID4059
Uniprot Accession IDs P50895 A8MYF9 A9YWT5 A9YWT6 Q86VC7
Ensembl ID ENSP00000270233
Symbol LU MSK19 AU LU CD239 MSK19
Sequence
MEPPDAPAQARGAPRLLLLAVLLAAHPDAQAEVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGWVREGDTVQLLCRGDGSPSPEYTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQAGVAVMAVAVSVGLLLLVVAVFYCVRRKGGPCCRQRREKGAPPPGEPGLSHSGSEQPEQTGLLMGGASGGARGGSGGFGDEC
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp744276BCAMbasal cell adhesion molecule 9598VGNC:2582OMA, EggNOG
Macaque714568BCAMbasal cell adhesion molecule (Lutheran blood group)9544Inparanoid, OMA, EggNOG
Mouse57278Bcambasal cell adhesion molecule10090MGI:1929940Inparanoid, OMA, EggNOG
Rat78958Bcambasal cell adhesion molecule (Lutheran blood group)10116RGD:68378Inparanoid, OMA, EggNOG
Dog484456BCAMbasal cell adhesion molecule9615VGNC:49023Inparanoid, OMA, EggNOG
Horse100070622BCAMbasal cell adhesion molecule9796VGNC:51000Inparanoid, OMA, EggNOG
Cow282862BCAMbasal cell adhesion molecule9913VGNC:49138Inparanoid, OMA, EggNOG
Pig100738241BCAMbasal cell adhesion molecule (Lutheran blood group)9823OMA, EggNOG
Anole lizard103281770bcambasal cell adhesion molecule (Lutheran blood group)28377Inparanoid, OMA, EggNOG
Xenopus100036718bcambasal cell adhesion molecule (Lutheran blood group)8364XB-GENE-921467Inparanoid, OMA, EggNOG
Zebrafish767689bcambasal cell adhesion molecule (Lutheran blood group)7955ZDB-GENE-060929-620Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    cell adhesion molecule    /    immunoglobulin superfamily cell adhesion molecule    /    Basal cell adhesion molecule
protein    /    cell adhesion molecule    /    receptor    /    Basal cell adhesion molecule
DTO Classes
protein    /    Cell adhesion    /    Immunoglobulin superfamily cell adhesion molecule    /    Basal cell adhesion molecule

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.