224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Betaine--homocysteine S-methyltransferase 1 |
|---|
Gene and Protein Information
| Gene ID | 635 |
|---|---|
| Uniprot Accession IDs | Q93088 Q9UNI9 |
| Ensembl ID | ENSP00000274353 |
| Symbol | BHMT1 HEL-S-61p |
| Sequence | MPPVGGKKAKKGILERLNAGEIVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQEVNEAACDIARQVADEGDALVAGGVSQTPSYLSCKSETEVKKVFLQQLEVFMKKNVDFLIAEYFEHVEEAVWAVETLIASGKPVAATMCIGPEGDLHGVPPGECAVRLVKAGASIIGVNCHFDPTISLKTVKLMKEGLEAARLKAHLMSQPLAYHTPDCNKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFEKQKFKSQ Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 714363 | BHMT | betaine--homocysteine S-methyltransferase | 9544 | OMA, EggNOG | |
| Mouse | 12116 | Bhmt | betaine-homocysteine methyltransferase | 10090 | MGI:1339972 | Inparanoid, OMA |
| Mouse | 329008 | Gm5096 | predicted gene 5096 | 10090 | MGI:3643681 | OMA, EggNOG |
| Rat | 81508 | Bhmt | betaine-homocysteine S-methyltransferase | 10116 | RGD:621496 | Inparanoid, OMA, EggNOG |
| Dog | 479171 | BHMT | betaine--homocysteine S-methyltransferase | 9615 | VGNC:38447 | Inparanoid, OMA, EggNOG |
| Horse | 100073265 | LOC100073265 | betaine--homocysteine S-methyltransferase 1 | 9796 | OMA, EggNOG | |
| Cow | 497025 | BHMT | betaine--homocysteine S-methyltransferase | 9913 | VGNC:26488 | Inparanoid, OMA, EggNOG |
| Pig | 397371 | BHMT | betaine--homocysteine S-methyltransferase | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100032615 | BHMT | betaine--homocysteine S-methyltransferase | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | BHMT | betaine--homocysteine S-methyltransferase [Source:HGNC Symbol;Acc:HGNC:1047] | 9258 | OMA, EggNOG | ||
| Chicken | 416371 | BHMT | betaine--homocysteine S-methyltransferase | 9031 | CGNC:50233 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100558455 | LOC100558455 | betaine--homocysteine S-methyltransferase 1 | 28377 | OMA, EggNOG | |
| Xenopus | 496651 | bhmt | betaine--homocysteine S-methyltransferase | 8364 | XB-GENE-1008382 | Inparanoid, OMA, EggNOG |
| Zebrafish | 322228 | bhmt | betaine-homocysteine methyltransferase | 7955 | ZDB-GENE-030131-947 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.