224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | HLA class II histocompatibility antigen, DR beta 4 chain |
|---|
Gene and Protein Information
| Gene ID | 3126 |
|---|---|
| Uniprot Accession IDs | P13762 B0S863 O78042 P79664 Q29889 Q30163 Q6TLK6 Q860N4 Q861F3 Q8WLT9 Q9BS54 |
| Symbol | DR4 DRB4 HLA-DR4B |
| Family | Belongs to the MHC class II family. |
| Sequence | MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS |
Protein Classes
PANTHER Classes
protein / defense/immunity protein / major histocompatibility complex antigen / HLA class II histocompatibility antigen, DR beta 4 chain
protein / defense/immunity protein / major histocompatibility complex antigen / HLA class II histocompatibility antigen, DR beta 4 chain
DTO Classes
protein / Immune response / Major histocompatibility complex antigen / HLA class II histocompatibility antigen, DR beta 4 chain
protein / Immune response / Major histocompatibility complex antigen / HLA class II histocompatibility antigen, DR beta 4 chain
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.