224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Probable inactive tRNA-specific adenosine deaminase-like protein 3 |
|---|
Gene and Protein Information
| Gene ID | 113179 |
|---|---|
| Uniprot Accession IDs | Q96EY9 |
| Ensembl ID | ENSP00000332448 |
| Symbol | TAD3 TAD3 MRT36 FWP005 MST121 S863-5 MSTP121 |
| Family | Belongs to the cytidine and deoxycytidylate deaminase family. ADAT3 subfamily. |
| Sequence | MEPAPGLVEQPKCLEAGSPEPEPAPWQALPVLSEKQSGDVELVLAYAAPVLDKRQTSRLLKEVSALHPLPAQPHLKRVRPSRDAGSPHALEMLLCLAGPASGPRSLAELLPRPAVDPRGLGQPFLVPVPARPPLTRGQFEEARAHWPTSFHEDKQVTSALAGRLFSTQERAAMQSHMERAVWAARRAAARGLRAVGAVVVDPASDRVLATGHDCSCADNPLLHAVMVCVDLVARGQGRGTYDFRPFPACSFAPAAAPQAVRAGAVRKLDADEDGLPYLCTGYDLYVTREPCAMCAMALVHARILRVFYGAPSPDGALGTRFRIHARPDLNHRFQVFRGVLEEQCRWLDPDT Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 100113398 | Adat3 | adenosine deaminase, tRNA-specific 3 | 10090 | MGI:1924344 | Inparanoid, EggNOG |
| Opossum | 100018548 | ADAT3 | adenosine deaminase, tRNA specific 3 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | ADAT3 | adenosine deaminase, tRNA specific 3 [Source:HGNC Symbol;Acc:HGNC:25151] | 9258 | OMA, EggNOG | ||
| Anole lizard | 100557633 | adat3 | adenosine deaminase, tRNA specific 3 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | adat3 | adenosine deaminase, tRNA-specific 3 [Source:Xenbase;Acc:XB-GENE-6258400] | 8364 | OMA, EggNOG | ||
| Zebrafish | 368634 | adat3 | adenosine deaminase, tRNA-specific 3 | 7955 | ZDB-GENE-030616-531 | Inparanoid, OMA, EggNOG |
| Fruitfly | 37135 | CG10927 | CG10927 gene product from transcript CG10927-RA | 7227 | FBgn0034360 | Inparanoid, EggNOG |
| S.cerevisiae | 851027 | TAD3 | Tad3p | 4932 | S000004308 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.