224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Isoaspartyl peptidase/L-asparaginase |
|---|
Gene and Protein Information
| Gene ID | 80150 |
|---|---|
| Uniprot Accession IDs | Q7L266 B2R7Q0 Q567Q4 Q6P1P0 Q8NI34 Q9H6F7 |
| Ensembl ID | ENSP00000400057 |
| Symbol | ALP CRASH ALP ALP1 CRASH |
| Family | Belongs to the Ntn-hydrolase family. |
| Sequence | MNPIVVVHGGGAGPISKDRKERVHQGMVRAATVGYGILREGGSAVDAVEGAVVALEDDPEFNAGCGSVLNTNGEVEMDASIMDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQKNLGTVGAVALDCKGNVAYATSTGGIVNKMVGRVGDSPCLGAGGYADNDIGAVSTTGHGESILKVNLARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTSTSMPWAAAKDGKLHFGIDPDDTTITDLP Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 739620 | ASRGL1 | asparaginase like 1 | 9598 | VGNC:11263 | OMA, EggNOG |
| Macaque | 718871 | ASRGL1 | asparaginase like 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 66514 | Asrgl1 | asparaginase like 1 | 10090 | MGI:1913764 | Inparanoid, OMA, EggNOG |
| Rat | 246307 | Asrgl1 | asparaginase like 1 | 10116 | RGD:708526 | Inparanoid, OMA, EggNOG |
| Dog | 483789 | ASRGL1 | asparaginase like 1 | 9615 | VGNC:38192 | Inparanoid, OMA, EggNOG |
| Horse | 100146576 | ASRGL1 | asparaginase like 1 | 9796 | VGNC:15594 | Inparanoid, OMA, EggNOG |
| Cow | 767970 | ASRGL1 | asparaginase like 1 | 9913 | VGNC:26223 | Inparanoid, OMA, EggNOG |
| Pig | 100517023 | ASRGL1 | asparaginase like 1 | 9823 | OMA, EggNOG | |
| Opossum | 100011584 | ASRGL1 | asparaginase like 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 421868 | ASRGL1 | asparaginase like 1 | 9031 | CGNC:11904 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100568030 | asrgl1 | asparaginase like 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100145284 | asrgl1 | asparaginase like 1 | 8364 | XB-GENE-989502 | Inparanoid, OMA |
| Zebrafish | 541402 | asrgl1 | asparaginase like 1 | 7955 | ZDB-GENE-050320-102 | Inparanoid, OMA |
| Fruitfly | 32488 | CG7860 | CG7860 gene product from transcript CG7860-RA | 7227 | FBgn0030653 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.