224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | BTB/POZ domain-containing protein KCTD21 |
|---|
Gene and Protein Information
| Gene ID | 283219 |
|---|---|
| Uniprot Accession IDs | Q4G0X4 B4DTR0 |
| Ensembl ID | ENSP00000339340 |
| Symbol | KCASH2 |
| Sequence | MSDPITLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKRDSQGNCFIDRDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKEVELSKAEKNAMLNITLNQRVQTVHFTVREAPQIYSLSSSSMEVFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTLDWVANVEGLPEEEYTKQNLKRLWVVPANKQINSFQVFVEEVLKIALSDGFCIDSSHPHALDFMNNKIIRLIRYR |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 622320 | Kctd21 | potassium channel tetramerisation domain containing 21 | 10090 | MGI:3643121 | Inparanoid, OMA, EggNOG |
| Dog | 608875 | KCTD21 | potassium channel tetramerization domain containing 21 | 9615 | VGNC:52263 | Inparanoid, OMA, EggNOG |
| Horse | 100062932 | KCTD21 | potassium channel tetramerization domain containing 21 | 9796 | VGNC:19324 | Inparanoid, OMA, EggNOG |
| Cow | 539645 | KCTD21 | potassium channel tetramerization domain containing 21 | 9913 | VGNC:30511 | Inparanoid, OMA, EggNOG |
| Opossum | 100017978 | KCTD21 | potassium channel tetramerization domain containing 21 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | KCTD21 | potassium channel tetramerization domain containing 21 [Source:HGNC Symbol;Acc:HGNC:27452] | 9258 | OMA, EggNOG | ||
| Chicken | 428098 | KCTD21 | potassium channel tetramerization domain containing 21 | 9031 | CGNC:12972 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100552020 | kctd21 | potassium channel tetramerization domain containing 21 | 28377 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.