🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

PNPO

DescriptionPyridoxine-5'-phosphate oxidase

Gene and Protein Information

Gene ID55163
Uniprot Accession IDs Q9NVS9 B4E0V0 B4E152 B4E1D7 D3DTT9
Ensembl ID ENSP00000225573
Symbol PDXPO HEL-S-302
FamilyBelongs to the pyridoxamine 5'-phosphate oxidase family.
Sequence
MTCWLRGVTATFGRPAEWPGYLSHLCGRSAAMDLGPMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFFTNFESRKGKELDSNPFASLVFYWEPLNRQVRVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp749248PNPOpyridoxamine 5'-phosphate oxidase9598VGNC:9532OMA, EggNOG
Macaque694949PNPOpyridoxamine 5'-phosphate oxidase9544OMA, EggNOG
Mouse103711Pnpopyridoxine 5'-phosphate oxidase10090MGI:2144151OMA, EggNOG
Rat64533Pnpopyridoxamine 5'-phosphate oxidase10116RGD:621456OMA, EggNOG
Dog480540PNPOpyridoxamine 5'-phosphate oxidase9615VGNC:44759OMA, EggNOG
Horse100055489PNPOpyridoxamine 5'-phosphate oxidase9796VGNC:21639OMA, EggNOG
Cow512573PNPOpyridoxamine 5'-phosphate oxidase9913VGNC:33096OMA, EggNOG
Opossum100020042PNPOpyridoxamine 5'-phosphate oxidase13616OMA, EggNOG
PlatypusPNPOpyridoxamine 5'-phosphate oxidase [Source:HGNC Symbol;Acc:HGNC:30260]9258OMA, EggNOG
Anole lizard100551742pnpopyridoxamine 5'-phosphate oxidase28377OMA, EggNOG
Xenopus100144978pnpopyridoxamine 5'-phosphate oxidase8364XB-GENE-955839OMA, EggNOG
Zebrafish402868pnpopyridoxamine 5'-phosphate oxidase7955ZDB-GENE-060602-2OMA, EggNOG
S.cerevisiae852323PDX3pyridoxamine-phosphate oxidase PDX34932S000000239OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    oxidase    /    Pyridoxine-5'-phosphate oxidase
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Oxidase    /    Pyridoxine-5'-phosphate oxidase

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.