224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Spindlin-4 |
|---|
Gene and Protein Information
| Gene ID | 139886 |
|---|---|
| Uniprot Accession IDs | Q56A73 B3KX90 Q5JUL2 |
| Ensembl ID | ENSP00000334163 |
| Symbol | TDRD28 |
| Family | Belongs to the SPIN/STSY family. |
| Sequence | MSPPTVPPMGVDGVSAYLMKKRHTHRKQRRKPTFLTRRNIVGCRIQHGWKEGNEPVEQWKGTVLEQVSVKPTLYIIKYDGKDSVYGLELHRDKRVLALEILPERVPTPRIDSRLADSLIGKAVEHVFEGEHGTKDEWKGMVLARAPVMDTWFYITYEKDPVLYMYTLLDDYKDGDLRIIPDSNYYFPTAEQEPGEVVDSLVGKQVEHAKDDGSKRTGIFIHQVVAKPSVYFIKFDDDIHIYVYGLVKTP |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 106995225 | SPIN4 | spindlin family member 4 | 9544 | Inparanoid, OMA | |
| Mouse | 270624 | Spin4 | spindlin family, member 4 | 10090 | MGI:2444925 | Inparanoid, OMA |
| Dog | 480938 | SPIN4 | spindlin family member 4 | 9615 | VGNC:46743 | Inparanoid, OMA |
| Horse | 100070371 | SPIN4 | spindlin family member 4 | 9796 | VGNC:23522 | Inparanoid, OMA |
| Cow | 540146 | SPIN4 | spindlin family member 4 | 9913 | VGNC:35218 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.