BNIP1

DescriptionVesicle transport protein SEC20

Gene and Protein Information

Gene ID662
Uniprot Accession IDs Q12981 D3DQM3 D3DQM4 D3DQM5 D3DQM6 O75622 O75623 O75624 Q6K044 Q96FG4
Ensembl ID ENSP00000231668
Symbol NIP1 SEC20L NIP1 SEC20 TRG-8
FamilyBelongs to the SEC20 family.
Sequence
MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALALFLATVLYIVKKRLFPFL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp740480BNIP1BCL2 interacting protein 19598VGNC:6383Inparanoid, OMA, EggNOG
Macaque703576BNIP1BCL2 interacting protein 19544Inparanoid, OMA, EggNOG
Mouse224630Bnip1BCL2/adenovirus E1B interacting protein 110090MGI:109328Inparanoid, OMA, EggNOG
Rat140932Bnip1BCL2 interacting protein 110116RGD:620799Inparanoid, OMA, EggNOG
Dog609594BNIP1BCL2 interacting protein 19615VGNC:38492Inparanoid, OMA, EggNOG
HorseBNIP1BCL2 interacting protein 1 [Source:HGNC Symbol;Acc:HGNC:1082]9796OMA, EggNOG
Cow614520BNIP1BCL2 interacting protein 19913VGNC:26531Inparanoid, OMA, EggNOG
Pig100521935BNIP1BCL2 interacting protein 19823OMA, EggNOG
PlatypusBNIP1BCL2 interacting protein 1 [Source:HGNC Symbol;Acc:HGNC:1082]9258OMA, EggNOG
Chicken416207BNIP1BCL2 interacting protein 19031CGNC:50191Inparanoid, OMA, EggNOG
Anole lizard100557936bnip1BCL2 interacting protein 128377Inparanoid, OMA, EggNOG
Xenopus780363bnip1BCL2/adenovirus E1B 19kDa interacting protein 18364XB-GENE-977996Inparanoid, OMA, EggNOG
Zebrafish565822bnip1aBCL2 interacting protein 1a7955ZDB-GENE-081107-44Inparanoid, OMA, EggNOG
C. elegans175187sec-20yeast SEC homolog6239Inparanoid, OMA, EggNOG
Fruitfly40724CG2023CG2023 gene product from transcript CG2023-RA7227FBgn0037383Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.