🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

TOMM22

DescriptionMitochondrial import receptor subunit TOM22 homolog

Gene and Protein Information

Gene ID56993
Uniprot Accession IDs Q9NS69 hTom22
Ensembl ID ENSP00000216034
Symbol TOM22 1C9-2 TOM22 MST065 MSTP065
FamilyBelongs to the Tom22 family.
Sequence
MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp743431TOMM22translocase of outer mitochondrial membrane 229598VGNC:8866OMA, EggNOG
Macaque701286TOMM22translocase of outer mitochondrial membrane 229544Inparanoid, OMA, EggNOG
Mouse223696Tomm22translocase of outer mitochondrial membrane 2210090MGI:2450248Inparanoid, OMA, EggNOG
Rat300075Tomm22translocase of outer mitochondrial membrane 2210116RGD:1303260Inparanoid, OMA, EggNOG
Dog610117TOMM22translocase of outer mitochondrial membrane 229615Inparanoid, OMA
Dog100855486LOC100855486mitochondrial import receptor subunit TOM22 homolog9615OMA, EggNOG
Horse100070131TOMM22translocase of outer mitochondrial membrane 229796VGNC:49131Inparanoid, OMA, EggNOG
Cow510780TOMM22translocase of outer mitochondrial membrane 229913VGNC:49064Inparanoid, OMA, EggNOG
Pig100520786TOMM22translocase of outer mitochondrial membrane 229823OMA, EggNOG
Opossum100013414TOMM22translocase of outer mitochondrial membrane 2213616OMA, EggNOG
PlatypusTOMM22translocase of outer mitochondrial membrane 22 [Source:HGNC Symbol;Acc:HGNC:18002]9258OMA, EggNOG
Chicken770933TOMM22translocase of outer mitochondrial membrane 229031CGNC:13830Inparanoid, EggNOG
Anole lizard100563605tomm22translocase of outer mitochondrial membrane 2228377Inparanoid, OMA, EggNOG
Xenopus734118tomm22translocase of outer mitochondrial membrane 22 homolog8364XB-GENE-951173Inparanoid, OMA, EggNOG
Zebrafish321232tomm22translocase of outer mitochondrial membrane 22 homolog (yeast)7955ZDB-GENE-030131-9810Inparanoid, OMA, EggNOG
C. elegans173436tomm-22Mitochondrial import receptor subunit TOM22 homolog6239Inparanoid, OMA
Fruitfly38459mgemaggie7227FBgn0035473Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.