🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

TMEM9B

DescriptionTransmembrane protein 9B

Gene and Protein Information

Gene ID56674
Uniprot Accession IDs Q9NQ34 Q7Z649
Ensembl ID ENSP00000433361
Symbol C11orf15 C11orf15
FamilyBelongs to the TMEM9 family.
Sequence
MATLWGGLLRLGSLLSLSCLALSVLLLAQLSDAAKNFEDVRCKCICPPYKENSGHIYNKNISQKDCDCLHVVEPMPVRGPDVEAYCLRCECKYEERSSVTIKVTIIIYLSILGLLLLYMVYLTLVEPILKRRLFGHAQLIQSDDDIGDHQPFANAHDVLARSRSRANVLNKVEYAQQRWKLQVQEQRKSVFDRHVVLS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp451732TMEM9BTMEM9 domain family member B9598VGNC:6547OMA, EggNOG
Mouse56786Tmem9bTMEM9 domain family, member B10090MGI:1915254Inparanoid, OMA, EggNOG
Rat293415Tmem9bTMEM9 domain family, member B10116RGD:1310775Inparanoid, OMA
Dog476843TMEM9BTMEM9 domain family member B9615VGNC:47619Inparanoid, OMA, EggNOG
Horse100071051TMEM9BTMEM9 domain family member B9796VGNC:24329Inparanoid, OMA, EggNOG
Cow515665TMEM9BTMEM9 domain family member B9913VGNC:36131Inparanoid, OMA, EggNOG
Opossum100029526TMEM9BTMEM9 domain family member B13616Inparanoid, OMA, EggNOG
Chicken423051TMEM9BTMEM9 domain family member B9031CGNC:4414Inparanoid, OMA, EggNOG
Anole lizard100560755tmem9bTMEM9 domain family member B28377Inparanoid, OMA, EggNOG
Zebrafish325931tmem9bTMEM9 domain family, member B7955ZDB-GENE-030131-4656Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.