Recombinant Human EGF Protein

Cat. No.: rp186557
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Accession #
P01133
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured in a cell proliferation assay using BALB/c mouse embryos cells. The ED50 for this effect is 0.67 ng/mL.
Size
USA
Alemania (EU)*
Price
Qty
10μg
rp186557-10μg
8 Disponible
19,90US$
50μg
rp186557-50μg
3 Disponible

37,90US$

49,90US$
Guardar 12,00 US$ (24.05%)
100μg
rp186557-100μg
3 Disponible

54,90US$

79,90US$
Guardar 25,00 US$ (31.29%)
1mg
rp186557-1mg
Fabricado bajo pedido en EE. UU. · 2–4 semanas ·

314,90US$

439,90US$
Guardar 125,00 US$ (28.42%)
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,High Performance,His Tag,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Bioactive,Carrier Free,High Performance,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human EGF Protein
Sinónimos
Beta urogastrone | beta-urogastrone | EGF | EGF_HUMAN | Epidermal growth factor | HOMG4 | OTTHUMP00000219721 | OTTHUMP00000219722 | Pro epidermal growth factor | URG | Urogastrone
Grado
ActiBioPure™, Bioactive, Carrier Free, High Performance, His Tag, PBS Only
Especificaciones y pureza
Carrier Free,Bioactive,ActiBioPure™,High Performance,His Tag,PBS Only,≥95%(SDS-PAGE)
Mecanismos bioquímicos y fisiológicos
EGF is the prototypic member of a family of growth factors that also includes amphiregulin, betacellulin, epigen, epiregulin, HB-EGF, neuregulins-1 through -6, and TGF-alpha. These proteins contain EGF-like domains with three intramolecular disulfide bond
Bioactividad
Measured in a cell proliferation assay using BALB/c mouse embryos cells. The ED50 for this effect is 0.67 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
971-1023 aa
Secuencia
MGSSHHHHHHSSGLVPRGSHMNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Número de adhesión
Peso molecular previsto
8.5 kDa
SDS-PAGE
10.8 kDa, under reducing conditions; 10.8 & 11.9 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze/thaw cycle.
Imágenes

Recombinant Human EGF Protein (rp186557) - Protein Bioactivity
Measured in a cell proliferation assay using BALB/c mouse embryos cells. The ED50 for this effect is 0.67 ng/mL.

Recombinant Human EGF Protein (rp186557) - SDS-PAGE
1.5 μg/lane of Recombinant Human EGF Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 10.8 kDa under reducing conditions and 10.8 & 11.9 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F1216168Certificate of AnalysisAug 04, 2026 rp186557
ZJ24F1216169Certificate of AnalysisAug 04, 2026 rp186557
ZJ25F0723970Certificate of AnalysisJun 16, 2026 rp186557
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.