Recombinant Human EGF Protein (FITC)

Cat. No.: rp170192
Disponible para pedir
GRADE & PURITY Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. Ex:498nm ? Fluorescence excitation maximum at 498 nm — the wavelength of light that best excites this fluorophore. Match it to your instrument's laser or filter set for the strongest signal. Em:517nm ? Fluorescence emission maximum at 517 nm — the wavelength this fluorophore emits after excitation. Use it to pick the right detection filter and avoid channel cross-talk.
Expression System
Pichia pastoris
Accession #
P01133
Protein Tag
No tag
Expression system
Pichia pastoris
Bioactivity
Binding EGFR
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp170192-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
799,90US$
20μg
rp170192-20μg
4
999,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

ActiBioPure™, Azide Free, Bioactive, Ex:498nm, Em:517nm ActiBioPure™,Azide Free,Bioactive,Em:517nm,Ex:498nm for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Protected from light,Store at -20°C Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Introduction:
Epidermal growth factor (EGF) is a hormone that stimulates division of epidermal and other cells. EGF (FITC) conjugate, which remains fully active after conjugation and can be used to study EGF receptor in cells. Fluorescently labeled EGF has enabled researchers to investigate receptor-membrane interactions, study receptor distribution, calculate rate constants for the interaction of EGF with its receptor, and more.
Conjugation:
The EGF was conjugated with FITC under optimum conditions, and unreacted FITC was removed. The number of fluorophore molecules on each EGF molecule is 1.0.
Recommended Usage:
Fluorescence is typically monitored using a flow cytometer, fluorescence microscope, or fluorimeter. For immunofluorescent staining, the recommended use of this reagent is ≤ 0.5µg per million cells in 100 µl staining volume. It is recommended that the reagent be titrated for optimal performance for different cell lines.

Specifications

Product Name
Recombinant Human EGF Protein (FITC)
Sinónimos
beta-urogastrone | EGF | epidermal growth factor (beta-urogastrone) | epidermal growth factor | hEGF | HOMG4 | pro-epidermal growth factor | URG | Urogastrone | EGF
Grado
ActiBioPure™, Azide Free, Bioactive, Em:517nm, Ex:498nm
Especificaciones y pureza
ActiBioPure™, Azide Free, Bioactive, Ex:498nm, Em:517nm
Bioactividad
Binding EGFR
Sistema de expresión
Pichia pastoris
Especie
Human
Aminoácidos
971-1021 aa
Secuencia
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWE
Etiqueta proteínica
No tag
Conjugación
FITC
Excitación (nm)
Blue Laser(488nm)
Emisión (nm)
517nm
Ex/Em(nm)
Número de adhesión
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
This product should be reconstituted in 100μL of deionized water to make a 0.2mg/mL stock solution. Prepare working dilution on day of use. Stock solution is stable for about 8 weeks at 2-8°C as an undiluted liquid. Avoid freeze-thaw cycles. Protect fluorescent conjugates from light.
Condiciones de almacenamiento de almacenamiento
Protected from light,Store at -20°C
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
The lyophilized products should be stored at –20°C until use. Allow the product to warm to room temperature before opening. Protect from light. When stored properly, the products should be stable for at least 12 months.
Imágenes

Recombinant Human EGF Protein (FITC) (rp170192) - Flow Cytometry
Flow analysis of EGF receptors (red line) in A431 Cells. Cells were labeled with Recombinant Human EGF Protein (FITC) (rp170192). Unlabeled A431 Cells (black line) were used as a negative control.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

2 results found

Lot NumberCertificate TypeFechaArticulo
ZJ23F0700646Certificate of AnalysisApr 09, 2026 rp170192
ZJ23R0700043Certificate of AnalysisJul 17, 2023 rp170192
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.