Recombinant Human EGF Protein (Biotin)

Cat. No.: rp170191
Disponible para pedir
GRADE & PURITY Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory.
Expression System
Pichia pastoris
Accession #
P01133
Protein Tag
No tag
Expression system
Pichia pastoris
Bioactivity
Binding EGFR
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp170191-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
799,90US$
20μg
rp170191-20μg
3
999,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

ActiBioPure™, Azide Free, Bioactive ActiBioPure™,Azide Free,Bioactive for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at 2-8°C,Protected from light Ships Wet ice Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Introduction:
Epidermal growth factor (EGF) is a hormone that stimulates division of epidermal and other cells. Labeling with biotinylated EGF can be followed by second-step labeling with streptavidin conjugates. Biotinylated EGF has enabled researchers to investigate receptor-membrane interactions, study receptor distribution, calculate rate constants for the interaction of EGF with its receptor, and more.
Conjugation:
The EGF was conjugated with Biotin under optimum conditions, and unreacted Biotin was removed.
Recommended Usage:
Fluorescence is typically monitored using a flow cytometer, fluorescence microscope, or fluorimeter. For immunofluorescent staining, the recommended use of this reagent is ≤ 0.5µg per million cells in 100 µl staining volume. It is recommended that the reagent be titrated for optimal performance for different cell lines.

Specifications

Product Name
Recombinant Human EGF Protein (Biotin)
Sinónimos
beta-urogastrone | EGF | epidermal growth factor (beta-urogastrone) | epidermal growth factor | hEGF | HOMG4 | pro-epidermal growth factor | URG | Urogastrone | EGF
Grado
ActiBioPure™, Azide Free, Bioactive
Especificaciones y pureza
ActiBioPure™, Azide Free, Bioactive
Bioactividad
Binding EGFR
Sistema de expresión
Pichia pastoris
Especie
Human
Aminoácidos
971 - 1021 aa
Secuencia
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWE
Etiqueta proteínica
No tag
Conjugación
Biotin
Número de adhesión
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
This product should be reconstituted in 100μL of deionized water to make a 0.2mg/mL stock solution. Prepare working dilution on day of use. Stock solution is stable for about 8 weeks at 2-8°C as an undiluted liquid. Avoid freeze-thaw cycles. Protect from light.
Condiciones de almacenamiento de almacenamiento
Store at 2-8°C,Protected from light
Enviado en
Wet ice
Estabilidad y almacenamiento
The lyophilized products should be stored at –20°C until use. Allow the product to warm to room temperature before opening. Protect from light. When stored properly, the products should be stable for at least 12 months.
Imágenes

Recombinant Human EGF Protein (Biotin) (rp170191) - Flow Cytometry
Flow analysis of EGF receptors (red line) in A431 Cells. Cells were labeled with Recombinant Human EGF Protein (Biotin) (rp170191) at 1/2500 dilution for 1 hour at 4°C, and then incubated with Streptavidin protein (APC) (np169048) at a dilution of 1/400 for 30 minutes at 4°C in the dark. Unlabeled Cells (black line) were used as a negative control.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

2 results found

Lot NumberCertificate TypeFechaArticulo
ZJ23F0700645Certificate of AnalysisApr 09, 2026 rp170191
ZJ23R0700042Certificate of AnalysisJul 17, 2023 rp170191
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.