Recombinant Human EGF Protein, ＞95% SDS-PAGE, CAS No.62253-63-8

CAS: 62253-63-8 Cat. No.: rp145392 Peso molecular: 6.5kD Número EC: 810-845-4 PubChem CID: 16143379

GRADE & PURITY Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, PBS Only, ≥95%(SDS-PAGE)

Expression System

Pichia pastoris

Accession #

P01133

Protein Tag

No tag

Expression system

Pichia pastoris

Endotoxin Concentration

<0.2 EU/μg

Bioactivity

Measured in a cell proliferation assay using BALB/3T3 mouse embryo fibroblasts cell line. The ED₅₀ for this effect is typically <0.9 ng/mL.

Specifications

Product Name

Recombinant Human EGF Protein, ＞95% SDS-PAGE, CAS No.62253-63-8

Sinónimos

beta-urogastrone | EGF | epidermal growth factor (beta-urogastrone) | epidermal growth factor | hEGF | HOMG4 | pro-epidermal growth factor | URG | Urogastrone | EGF

Grado

ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, PBS Only

Especificaciones y pureza

Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, PBS Only, ≥95%(SDS-PAGE)

Mecanismos bioquímicos y fisiológicos

EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR

Pureza

＞95% SDS-PAGE

Bioactividad

Measured in a cell proliferation assay using BALB/3T3 mouse embryo fibroblasts cell line. The ED₅₀ for this effect is typically <0.9 ng/mL.

Concentración de endotoxinas

<0.2 EU/μg

Sistema de expresión

Pichia pastoris

Especie

Human

Aminoácidos

971-1021 aa

Secuencia

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWE

Etiqueta proteínica

No tag

Longitud de la proteína

Full length protein

Número de adhesión

P01133

Fuente

Recombinant

Peso molecular previsto

6 kDa

CAS

62253-63-8

Tipo de molécula

Protein

Almacenamiento y envío

Forma

Lyophilized

Reconstitución

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile 10mM PBS to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 ℃. Further dilutions should be made in appropriate buffered solutions.

Condiciones de almacenamiento de almacenamiento

Store at -20°C,Avoid repeated freezing and thawing

Enviado en

Ice chest + Ice pads

Estabilidad y almacenamiento

Store at 2-8℃ short term (4 weeks). Store at -20℃ long term (24 months). Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.

Imágenes

Protein Bioactivity: Recombinant Human EGF Protein (rp145392)

Recombinant Human EGF Protein (rp145392)-Protein Bioactivity
Measured in a cell proliferation assay using BALB/3T3 mouse embryo fibroblasts cell line. The ED₅₀ for this effect is typically <0.9ng/mL.

SDS-PAGE: Recombinant Human EGF Protein (rp145392)

Recombinant Human EGF Protein (rp145392)-SDS-PAGE
5μg/lane of Recombinant Human EGF was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 6.6 kDa.

Taxonomic Classification

Taxonomy Tree

• Kingdom Organic compounds
  • Superclass Organic Polymers
    • Clase Polypeptides

• Kingdom: Organic compounds
• Superclass: Organic Polymers
• Clase: Polypeptides
• Subclass: Not available
• Intermediate Tree Nodes: Not available
• Direct Parent: Polypeptides
• Alternative Parents: Peptides Tyrosine and derivatives Arginine and derivatives Phenylalanine and derivatives Histidine and derivatives Glutamic acid and derivatives Glutamine and derivatives Asparagine and derivatives Aspartic acid and derivatives Isoleucine and derivatives Leucine and derivatives Methionine and derivatives N-acyl-L-alpha-amino acids Valine and derivatives Proline and derivatives Serine and derivatives Cysteine and derivatives Tryptamines and derivatives Alpha amino acid amides Alanine and derivatives 3-alkylindoles Amphetamines and derivatives N-acylpyrrolidines Pyrrolidinecarboxamides 1-hydroxy-2-unsubstituted benzenoids Substituted pyrroles N-acyl amines Tertiary carboxylic acid amides Heteroaromatic compounds Imidazoles Guanidines Secondary carboxylic acid amides Primary carboxylic acid amides Amino acids Carboximidamides Carboxylic acids Dialkylthioethers Sulfenyl compounds Alkylthiols Azacyclic compounds Carbonyl compounds Hydrocarbon derivatives Imines Monoalkylamines Organic oxides Primary alcohols
• Molecular Framework: Aromatic heteropolycyclic compounds
• Substituents: Polypeptide - Alpha peptide - Tyrosine or derivatives - Arginine or derivatives - Phenylalanine or derivatives - Histidine or derivatives - Glutamic acid or derivatives - Glutamine or derivatives - Methionine or derivatives - Asparagine or derivatives - Aspartic acid or derivatives - Leucine or derivatives - Isoleucine or derivatives - N-acyl-l-alpha-amino acid - N-acyl-alpha amino acid or derivatives - N-acyl-alpha-amino acid - Valine or derivatives - Proline or derivatives - Triptan - Alpha-amino acid amide - Serine or derivatives - Cysteine or derivatives - Alanine or derivatives - 3-alkylindole - Amphetamine or derivatives - N-substituted-alpha-amino acid - Alpha-amino acid or derivatives - Indole - Indole or derivatives - N-acylpyrrolidine - Pyrrolidine carboxylic acid or derivatives - Pyrrolidine-2-carboxamide - 1-hydroxy-2-unsubstituted benzenoid - Phenol - Benzenoid - Fatty acyl - Monocyclic benzene moiety - Fatty amide - Substituted pyrrole - N-acyl-amine - Pyrrolidine - Pyrrole - Imidazole - Tertiary carboxylic acid amide - Heteroaromatic compound - Azole - Amino acid or derivatives - Carboxamide group - Guanidine - Secondary carboxylic acid amide - Primary carboxylic acid amide - Amino acid - Dialkylthioether - Carboximidamide - Azacycle - Organoheterocyclic compound - Carboxylic acid derivative - Carboxylic acid - Thioether - Sulfenyl compound - Alkylthiol - Hydrocarbon derivative - Primary amine - Organonitrogen compound - Carbonyl group - Organooxygen compound - Organosulfur compound - Primary alcohol - Organic nitrogen compound - Organic oxide - Imine - Alcohol - Primary aliphatic amine - Organic oxygen compound - Amine - Aromatic heteropolycyclic compound
• Descripción: This compound belongs to the class of organic compounds known as polypeptides. These are peptides containing ten or more amino acid residues.
• External Descriptors: Not available

Data sources

1. Djoumbou Feunang Y, Eisner R, Knox C, Chepelev L, Hastings J, Owen G, Fahy E, Steinbeck C, Subramanian S, Bolton E, Greiner R, and Wishart DS. ClassyFire: Automated Chemical Classification With A Comprehensive, Computable Taxonomy. Journal of Cheminformatics, 2016, 8:61.

DOI: 10.1186/s13321-016-0174-y

Referencias

1. Xiaoli Lu, Shangwen Sun, Na Li, Shuying Hu, Yuyao Pan, Lin Wang, Xuefeng Zhou, Hanbang Chen, Feimin Zhang.  (2024)  Janus sponge/electrospun fibre composite combined with EGF/bFGF/CHX promotes reconstruction in oral tissue regeneration.  COLLOIDS AND SURFACES B-BIOINTERFACES,      [PMID:39084056] [10.1016/j.colsurfb.2024.114117]

2. Zhang Jie, Chen Weiwu, Zhang Chen, He Qian, Wang Xudong, Han Jiayu, Gao Peng, Wang Kunyu, Xie Haoze, Gao Feng, Guo Yining, Guo Wenhao, Jiang Haofei, Le Jing, Zang Ruichen, Mo Sisi, Fan Haobo, Zhu Xiaoxiao, Jiang Xinrong, Gao Fengbin, Yu Yanlan, Ding Guoqing, Chen Yicheng.  (2025)  Prostate Cancer Cells Secrete PD-1 in Exosomes to Enhance Myeloid-Derived Suppressor Cell Activity and Promote Tumor Immune Evasion.  CANCER RESEARCH,      [PMID:40698651] [10.1158/0008-5472.CAN-24-3748]

3. Cao Mingbo, Ren Yupeng, Li Yuxuan, Deng Junfeng, Su Xiaorui, Tang Yongchang, Yuan Feng, Deng Haixia, Yang Gaoyuan, He Zhiwei, Liu Bo, Yao Zhicheng, Deng Meihai.  (2023)  Lnc-ZEB2-19 Inhibits the Progression and Lenvatinib Resistance of Hepatocellular Carcinoma by Attenuating the NF-κB Signaling Pathway through the TRA2A/RSPH14 Axis.  International Journal of Biological Sciences,  19  (12): (3678-3693).  [PMID:37564197] [10.7150/ijbs.85270]

4. Maoze Guo, Yuqiu Wang, Bingbing Gao, Bingfang He.  (2021)  Shark Tooth-Inspired Microneedle Dressing for Intelligent Wound Management.  ACS Nano,      [PMID:34533924] [10.1021/acsnano.1c06279]

5. Yang Min, Ma Yuejiang, Cao Zhu, Zhan Hong, Jin Ye, Huang Xiufeng, Yang Shizhou.  (2025)  HPV16 E7 Enhances Cell Stemness via RTKN2-Mediated Activation of the NF-κB Pathway in Cervical Cancer.  BIOCHEMICAL GENETICS,      [PMID:40495058] [10.1007/s10528-025-11144-w]

6. Xiaoshen Zhang, Tao Jiang, Lingyun Ye, Jianguo Sun, Lei Wang, Juanjuan Li, Fengying Wu, Shengxiang Ren, Guanghui Gao.  (2025)  WISP3 upregulates SDCBP expression to promote the progression of non-small cell lung cancer via the TGF-β signaling pathway.  BIOCHEMICAL PHARMACOLOGY,      [PMID:40571215] [10.1016/j.bcp.2025.117082]

7. Yang Shizhou, Wu Tingting, Cao Zhu, Chen Zhengyun, Ma Yuejiang, Wang Ting, Qian Linhua, Huang Xiufeng.  (2026)  Hypoxic glycolysis-driven histone lactylation activates NHE7 to promote endometrial cancer progression via COX6C-mediated endoplasmic reticulum stress.  APOPTOSIS,  31  (2): (55).  [PMID:41575611] [10.1007/s10495-026-02262-w]

8. Yunxia Du, Di Xiao, Changle Ren, Zhenlan Li, Xiaofeng Wang, Yantao Zhao, Yongmei Jiang.  (2026)  pH-responsive polydopamine-shelled 3D-printed chitosan/collagen hydrogel integrating exosomes and an enzyme/peptide cascade for diabetic wound healing.  Biomaterials Science,      [PMID:41685930] [10.1039/D5BM01823D]