Recombinant Human IFN-alpha-1a Protein

Cat. No.: rp222551
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE) See COA
Accession #
P01562
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human IFN-alpha-1a Protein (rp222551) at 1.0 μg/mL can bind Rontalizumab (anti-IFNA1) (Ab175647) with the EC50 of 60.2 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp222551-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
29,90US$
50μg
rp222551-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
89,90US$
100μg
rp222551-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
139,90US$
1mg
rp222551-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
949,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,His Tag,PBS Only,≥95%(SDS-PAGE),See COA ActiBioPure™,Bioactive,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human IFN-alpha-1a Protein
Sinónimos
IFL | IFN | I FNA@ | IFNA13 | IFN-ALPHA | IFN-alphaD | Interferon alpha-1/13 | leIF D | IFNA1 | IFNalpha 1 | IFN-alpha 1
Grado
ActiBioPure™, Bioactive, Carrier Free, His Tag, PBS Only
Especificaciones y pureza
Carrier Free, Bioactive, ActiBioPure™, His Tag, PBS Only, ≥95%(SDS-PAGE), See COA
Mecanismos bioquímicos y fisiológicos
Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Bioactividad
Immobilized Recombinant Human IFN-alpha-1a Protein (rp222551) at 1.0 μg/mL can bind Rontalizumab (anti-IFNA1) (Ab175647) with the EC50 of 60.2 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
24-189 aa
Secuencia
MHHHHHHCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE
Número de adhesión
Peso molecular previsto
20.3 kDa
SDS-PAGE
18.3 kDa, under reducing conditions; 16.8 & 33.1 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Concentración
See COA
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20℃ for 6 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes

Recombinant Human IFN-alpha-1a Protein (rp222551) - ELISA
Immobilized Recombinant Human IFN-alpha-1a Protein (rp222551) at 1.0 μg/mL can bind Rontalizumab (anti-IFNA1) (Ab175647) with the EC₅₀ of 60.2 ng/mL.

Recombinant Human IFN-alpha-1a Protein (rp222551) - SDS-PAGE
3 μg/lane of Recombinant Human IFN-alpha-1a Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 18.3 kDa under reducing conditions and 16.8 & 33.1 kDa under non-reducing conditions.
The observation of protein as both dimers and monomers under non-reducing (NR) conditions suggests that a portion of the protein forms dimers. This dimerization may be mediated by (or stabilized by) disulfide bonds (Uniprot: P01562).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.