Recombinant Human IFN-gamma Protein

Cat. No.: rp186559
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
P01579
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
1. Recombinant human IFN-gamma bioactivity is measured by inhibition of the proliferation of HT-29 cells.The EC50 for this effect is typically 1.41 ng/mL. 2. Immobilized Recombinant Human IFN-gamma protein (rp186559) at 1.0 μg/mL can bind Fontolizumab (anti-IFNG) (Ab175539) with the EC50 of 23.33 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp186559-10μg
4
45,90US$
50μg
rp186559-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
151,90US$
100μg
rp186559-100μg
1
239,90US$
1mg
rp186559-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
1.099,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,High Performance,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Bioactive,Carrier Free,High Performance,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human IFN-gamma Protein
Sinónimos
IFG | IFI | IFNG | IFNgamma | IFN-gamma | Immune interferon | interferon gamma | interferon, gamma
Grado
ActiBioPure™, Bioactive, Carrier Free, High Performance, PBS Only
Especificaciones y pureza
Carrier Free, Bioactive, ActiBioPure™, High Performance, PBS Only, ≥95%(SDS-PAGE)
Mecanismos bioquímicos y fisiológicos
IFN gamma, also known as IFNG, is a secreted protein that belongs to the type II interferon family. IFN gamma is produced predominantly by natural killer and natural killer T cells as part of the innate immune response, and by CD4 and CD8 cytotoxic T lymp
Bioactividad
1. Recombinant human IFN-gamma bioactivity is measured by inhibition of the proliferation of HT-29 cells.The EC50 for this effect is typically 1.41 ng/mL. 2. Immobilized Recombinant Human IFN-gamma protein (rp186559) at 1.0 μg/mL can bind Fontolizumab (anti-IFNG) (Ab175539) with the EC50 of 23.33 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
E. coli
Aminoácidos
24-166 aa
Secuencia
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Etiqueta proteínica
No tag
Número de adhesión
Peso molecular previsto
16.8 kDa
SDS-PAGE
14.1 kDa, under reducing conditions; 14.1 kDa, under non-reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Imágenes

Recombinant Human IFN-gamma Protein (rp186559) - Protein Bioactivity
Recombinant Human IFN-gamma bioactivity is measured by inhibition of the proliferation of HT-29 cells. The EC50 for this effect is typically 1.41 ng/mL.

Recombinant Human IFN-gamma Protein (rp186559) - ELISA
Immobilized Recombinant Human IFN-gamma protein (rp186559) at 1.0 μg/mL can bind Fontolizumab (anti-IFNG) (Ab175539) with the EC50 of 23.33 ng/mL.

Recombinant Human IFN-gamma Protein (rp186559) - SDS-PAGE
3 μg/lane of Recombinant Human IFN-gamma Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 14.1 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

5 results found

Lot NumberCertificate TypeFechaArticulo
ZJ25F0825138Certificate of AnalysisJun 22, 2026 rp186559
ZJ25F0825139Certificate of AnalysisJun 22, 2026 rp186559
ZJ25F0825140Certificate of AnalysisJun 22, 2026 rp186559
ZJ24F1011561Certificate of AnalysisMay 22, 2026 rp186559
ZJ25F0723582Certificate of AnalysisApr 07, 2026 rp186559
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.