Recombinant Human IFN-gamma Protein

Cat. No.: rp228944
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE) See COA
Accession #
P01579
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Recombinant human IFN-γ bioactivity is measured by inhibition of the proliferation of HT-29 cells. The EC50 for this effect is typically 0.07 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp228944-10μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
29,90US$
50μg
rp228944-50μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
89,90US$
100μg
rp228944-100μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
136,90US$
1mg
rp228944-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
849,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,PBS Only,≥95%(SDS-PAGE),See COA ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human IFN-gamma Protein
Sinónimos
IFG | IFI | IFNG | IFNgamma | IFN-gamma | Immune interferon | interferon gamma | interferon, gamma
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, PBS Only
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, PBS Only, ≥95%(SDS-PAGE), See COA
Mecanismos bioquímicos y fisiológicos
IFN gamma, also known as IFNG, is a secreted protein that belongs to the type II interferon family. IFN gamma is produced predominantly by natural killer and natural killer T cells as part of the innate immune response, and by CD4 and CD8 cytotoxic T lymp
Bioactividad
Recombinant human IFN-γ bioactivity is measured by inhibition of the proliferation of HT-29 cells. The EC50 for this effect is typically 0.07 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
24-166 aa
Secuencia
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Número de adhesión
Peso molecular previsto
16.8 kDa
SDS-PAGE
15.6 & 30.5 kDa, under reducing conditions; 15.6 & 30.5 kDa, under non-reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Concentración
See COA
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 2.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes
Recombinant Human IFN-gamma Protein (rp228944) - Protein Bioactivity 
Recombinant Human IFN-gamma Protein bioactivity is measured by inhibition of the proliferation of HT-29 cells. The EC50 for this effect is typically 0.07 ng/mL.
Recombinant Human IFN-gamma Protein (rp228944) - SDS-PAGE 
3 μg/lane of Recombinant Human IFN-gamma Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the bands at 15.6 & 30.5 kDa. IFN-gamma can form Homodimer (Uniprot: P01579).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ26F0433965Certificate of AnalysisApr 10, 2026 rp228944
ZJ26F0433964Certificate of AnalysisApr 10, 2026 rp228944
ZJ26F0433963Certificate of AnalysisApr 10, 2026 rp228944
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.